CAZyme Information: EEQ30269.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ30269.1
• CAZy Family: GH16
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1076		115161.18	4.5992

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995703:658778-662727(-)

Full Sequence      

MRSLFLTLASLYLFYLQLVSCDNIACGPNNQCALGCCSKSAKVCGYGPSYCHKDKCLAEG
SAHGTCSQKSECDPGVYPGWGENWGSDYANATHCPLNVCCSPYGFCGTTKDFCGDDTVAE
PRCGGSSATKRTIGYYEGWNLQRSCDTMEPEGIPIGGYTHINFAFLYINPITFLVEPMVK
NQEALYDRVAALKKRKPGLKVWASIGGWDFNDPSPTFRTFSQLAASPFGQFLFSQSLLAF
LEAHGFDGVDLDWEYPVASERGGSDVDYDNYVSWLANLRVALDGAGKGYGLSLTLPSSYW
YLQHFDIAKMAKSVDWFNMMSYDLHGLWDQNNKWIGSIVNGHTNLTEISLAMDLLWRNSI
KPDQVVMGLGFYGRSFTLKDPSCGTAGCPFSSAGRPGECTKSAGTLSFTEIEAILADPRR
GAKKVYDPVAAVEIVTFDNDQWVSYDDSKSFKAKMDYANSHCIGGTLVWAVSLDSDGTAT
NALTGTTKPFIDDDGSNGGSGDVYIGPDLWENSTHVVACEPPCTMVLPPFPIETPVTVNW
PAYTTSVLSSSAGTTYTKTTVINIPPFVVTEIPVWPVTVAEPGLSALFPPKQSIAPPPLI
LTLPATEAVFPVTHPEHTKTITTPSMPDPTTSGSATISTPAAVQPGMVSGCREFYKAMAG
DNCYGIATSHGTTLEKFIEWNPAVGADCSGLWANEYYCISVGSDSTITGGSTSGTASSTR
IPPVFHTTAHTITIQPQPTFTSIQPPTRTIPPLQYVDGKPPSSGGCTGGKPLSGCGVHDC
TLFGCGKCIGPGGDGDDSGDDDTTTTTTTSCTSSMTTTTACDTACSDSEDKACETICDTV
TVGGCQKDEPLWLQIETPVADPWPWLDESDEEMLSKALSVASFINPRLTAIDPITIDGTP
FTAGPAPTTTSTPVHTETSNCKVCTSTEGQKTSSCTFQDNCTPTPPPKPELSATCDFRSN
YGVAYRFTVWNIRGWANDHGMALKREEDGCATLSGWVFKEATAEKGASASFNLDYFIKAG
CVERAIVSAGGPKVECIEIVDFNAANHPDKPLQSPNATNTTTTRIRALRGRGSAIV

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	129	478	3.4e-65	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.05e-88	131	474	1	334	Glyco_18 domain.
119357	GH18_zymocin_alpha	2.90e-82	131	474	1	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119351	GH18_chitolectin_chitotriosidase	3.87e-75	149	474	19	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	1.51e-72	131	474	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	9.17e-59	133	476	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS08616.1|CBM18|CBM50|GH18	0.0	1	918	1	942
BCR96098.1|CBM18|CBM50|GH18	0.0	1	918	1	942
BCS04473.1|CBM18|CBM50|GH18	0.0	21	933	21	987
BCS16058.1|CBM18|CBM50|GH18	0.0	21	933	21	987
BCS02338.1|CBM18|GH18	1.87e-167	22	485	52	501

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUP_A	1.68e-42	131	474	94	438	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
6KST_A	3.52e-42	124	483	1	366	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	1.61e-41	124	483	1	366	Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
5WV8_A	1.84e-41	131	474	94	438	Crystal structure of a mutant insect group III chitinase (CAD1-E217L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVB_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)6 (CAD1-E217L-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
1HKK_A	8.29e-41	131	474	2	342	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	5.52e-46	56	472	302	710	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	2.57e-39	125	474	19	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q9D7Q1|CHIT1_MOUSE	8.20e-39	125	474	19	361	Chitotriosidase-1 OS=Mus musculus OX=10090 GN=Chit1 PE=1 SV=2
sp|Q5RBP6|CH3L1_PONAB	1.77e-38	131	474	50	384	Chitinase-3-like protein 1 OS=Pongo abelii OX=9601 GN=CHI3L1 PE=2 SV=1
sp|P36222|CH3L1_HUMAN	4.55e-38	131	474	23	357	Chitinase-3-like protein 1 OS=Homo sapiens OX=9606 GN=CHI3L1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000204	0.999756	CS pos: 21-22. Pr: 0.9817

TMHMM  Annotations     

There is no transmembrane helices in EEQ30269.1.