CAZyme Information: EEQ28799.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ28799.1
• CAZy Family: AA7
• CAZyme Description: alpha 1,6 mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	DS995702|CGC8	42290.00	5.5877

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995702:508452-509639(+)

Full Sequence      

MISFRKCVFIAFLILSGGFLLHAAHIKPVSANVEVETHHQRSEQPLRTSVTAKLESEPEP
EPKVESDPEPEPEPEPKTLRGRLKYHFPYGVTAKFPGYIWQTWKYTPASGDFDPTLRPLE
ASWTELHPGFIHQVVDDESALYFLKYLYASFPEIVEAYNSLPLPVLKADFFRYLILHARG
GIYSDIDTSALRPATEWIPSKFDRSTIGLVIGIEADPDRADWDKWYSRRIQFCQWTIQAK
PGHPVLRDVIANITEEALRMKVEGNLTDGKMDKSIVEFTGPAIWTDAVFRYLNDPFYFPS
EDGALRNISTPHFTGMTKQKQVGDIVVLPITSFSPGVQQMGSEEPDSDMAFVQHQFSGTW
KSLEDRRIGHW

Enzyme Prediction     

EC	2.4.1.257:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	121	200	8.6e-20	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.28e-40	77	362	64	346	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.09e-18	122	199	10	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11372.1|GT32	5.71e-156	1	362	1	354
ABA38731.1|GT32	1.01e-152	77	358	37	321
CBV36935.1|GT32	3.94e-147	1	362	1	355
BCR89353.1|GT32	1.97e-145	78	362	73	357
QKX63547.1|GT32	2.52e-145	77	369	75	365

PDB Hits     

EEQ28799.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	2.52e-84	78	361	82	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.36e-77	85	361	132	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	2.51e-69	78	370	79	479	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	4.17e-66	78	362	113	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.615412	0.384594

TMHMM  Annotations     

Start	End
7	26