CAZyme Information: EEQ28200.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ28200.1
• CAZy Family: AA6
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	DS995701|CGC5	46161.75	7.4211

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995701:2967645-2968978(+)

Full Sequence      

MWIHKYLYRRVRRFPVAVAVVATIWSFVEVLWIQRALIRQLDSEPGLLGDEKIYITSIHW
NNGNILREAWIPALVELVNAIGRDNVFVSLQESGSWDDSKAQLRHLDALLAQNDIPRRIV
LNDTTHLDEISRPPASTGWVETPIGQTELRRIPYLANLRNLVMGPLYERKEEGIFYDKIL
FLNDVVFNTLDIRRLLSTRGGSFAAACSLDFSKPPKFYDTFALRDIEGHDQLMQTWPYFR
SRVSRRAIKYGEPVPVKSCWNGAVAMDSSPFYNDPPLEFRGISDGLAKSHLEGSECCLIH
ADNPLSENMGVWLNPNVRVGYNTPAYATVNPERISWLSTLSIIGGLWENRVLRWFTTSWF
TEYTVKRRLSKYQKEDPGNIETGSFCLINEMQVLVANGWAHR

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	52	304	9.4e-82	0.9916317991631799

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	1.17e-117	52	299	1	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89692.1|GT69	4.85e-207	7	402	8	403
QMW30798.1|GT69	4.85e-207	7	402	8	403
QMW42851.1|GT69	4.85e-207	7	402	8	403
UDD59634.1|GT69	4.85e-207	7	402	8	403
UJO13624.1|GT69	1.59e-163	20	401	21	405

PDB Hits     

EEQ28200.1 has no PDB hit.

Swiss-Prot Hits     

EEQ28200.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000016

TMHMM  Annotations     

Start	End
13	32