CAZyme Information: EEQ27535.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ27535.1
• CAZy Family: AA11
• CAZyme Description: 1,2-alpha-D-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505		55945.76	5.1886

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

Full Sequence      

MKSLSLLGVFPLALALPAVNQNQNRFNILSGLADGDKPQAIKDAFTHAWNGYQTYAYPMD
ELRPVSNKGTNPLNGWGATPVDALSTAIIMDMPDVVDEILDHIENIDFSKTDYLCSLFET
TIRYLGGLLSGYDLLKDSYMNVDSKRVDILLQKATELADVLKFSFNSTSGIPWNNLNITA
QTTDGSTSNGLATVGTLVLEWTRLSDLTGKEEYGKLAQKAEGYLLDPQPKSSEVFPGLVG
GSINIKTHQFEHASASWEAGDDSFYEYLIKMYVYDNSAFGKYKDRWVLAAQSTMQHLKSS
PVGHPDTTFIGSWSNGGLVKGSQHLACFAGGNFILGGRELNRPDFIKFGLQLTDGCHKTY
IDTLTKIGPESFGWDENRVPSGQAKFFAKNGFYVNSSGYVMRPEVIESFYYAFRITGDKK
YRDWIWDAFVAISETTMTDSGFSSISNVNAAGGGSKTDSQPSFFFAETLKYTYLAHAEEA
DWQISSSGKDKFVFNTEAHPFRVRK

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	44	503	3e-134	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	44	503	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.47e-111	37	505	72	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABA54911.1|GH47	ABA54911.1|GH47	3.16e-215	7	503	14	514
BAA08275.1|GH47|3.2.1.113	BAA08275.1|GH47|3.2.1.113	6.79e-215	37	505	40	510
ABB36773.3|GH47|3.2.1.113	ABB36773.3|GH47|3.2.1.113	5.17e-214	7	503	14	514
BCS05959.1|GH47	BCS05959.1|GH47	6.06e-209	37	503	42	510
CAP94087.1|GH47	CAP94087.1|GH47	7.73e-209	37	503	39	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2RI8_A	6.48e-217	37	505	5	475	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	1KKT_A	2.34e-216	37	505	40	510	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
1HCU_A	1HCU_A	1.89e-145	31	504	9	493	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	5KKB_A	1.25e-67	36	503	21	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	1NXC_A	1.56e-67	36	503	19	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AV26|MNS1B_ARTBC	sp|D4AV26|MNS1B_ARTBC	8.04e-310	1	504	1	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|P31723|MAN12_PENCI	sp|P31723|MAN12_PENCI	1.21e-215	37	505	40	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|E9CXX8|MNS1B_COCPS	sp|E9CXX8|MNS1B_COCPS	9.19e-215	7	503	14	514	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q0D076|MNS1B_ASPTN	sp|Q0D076|MNS1B_ASPTN	2.52e-214	37	504	39	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|A2QAS2|MNS1B_ASPNC	sp|A2QAS2|MNS1B_ASPNC	6.18e-209	3	503	9	510	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999739	CS pos: 21-22. Pr: 0.6884

TMHMM  Annotations     

There is no transmembrane helices in EEQ27535.1.