CAZyme Information: EEP82071.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP82071.1
• CAZy Family: GT39
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
926		104782.52	7.0265

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476618:2354063-2356954(-)

Full Sequence      

MPPIPLHEAVQPDNNQMSNDGYFGNQGVLSSQNTDPKAQECSSSTPTAATRSGTESSSTS
PDTPSAAAKGAHSSRELLRRLSLMDGKPMPSIMTRPEEHADLHLTGRIISAAFCIPYKLR
FRSGMAWSQELHPRPGTSAIFDSFEYLASADNPWSHTLVGWTGEVEKSALQDCYFQSKPP
ETPGIESLSLETALMPINKASAPIPVNANHKPAPPPADGIHVTEGDRARLEGQLRTSKYG
SILPVWLADDTESPDQTIQLKDQARWRRYAEREVYPLFHYKQHGPTDGRSERRWWEDYQR
LNQLFADRILEVYRPGDIVWIHDYHLLLLPSILRQRIPGIYIGFFLHVPFPSSEFFRCLT
RRKEVLTGVLGANMVGFQSYTYSRHFSSCCTRILRFDSNSAGIDAYGAHVAVDVFPIGID
VDAVRKMAYGDDHTEKTIAEIKKLYAGKKIIIGRDRLDSVRGVTQKLMAFEMFLERYPQW
RDKVVLIQVTSPTSVEEEKEESEAKLSSQMSHLVSTINGKYGSLSFSPVQHYPQYLPRHE
YFALLRAADVGLITSVRDGMNTTSLEYVVCQHENHGPLILSEFSGTAGSLHKAIHINPWD
SGGVAAAINKALTMSPAQRQEQHEELYKYVTRHTVSRWSDLYVRRLLTNLSSFNQSIATP
LLDKTKLLYQYLKGRRRLFMFDYDGTLTPIVKDPQAAIPSDRVIRTLKSLAADPKNSVWI
ISGRDQNFLEEWMGHISELGLSAEHGCFIRKPHHDTWENLTEKSNMGWQKEVLDIFQHYT
ERTQGSFVERKRVALTWHYRRVDPEYGAYQARECRRHLENTVAKKWEVEIMAGKANLEVR
PTFVNKGEIASRLVNECQGQPDFVLCLGDDFTDEDMFRALRRSNLPADLVFSVTVGASSK
QTEASWHLLEPSDVIATVSLLNSCTD

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	241	646	6.8e-156	0.8189473684210526

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	241	646	71	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	215	926	49	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	1.33e-179	219	646	53	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.14e-158	269	877	181	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
223457	OtsA	1.29e-157	263	646	98	477	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS67563.1|GT20	0.0	61	925	58	920
QMW46130.1|GT20	0.0	55	923	71	939
QRD94182.1|GT20	0.0	55	923	4	872
BAE63282.1|GT20	0.0	55	923	4	872
QMW34075.1|GT20	0.0	55	923	71	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXN_A	5.32e-152	657	923	1	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	1.27e-146	659	923	3	271	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5DXF_A	2.65e-141	97	649	22	526	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	5.94e-94	659	921	5	297	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5HVM_A	4.05e-91	219	646	62	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	7.57e-226	107	921	15	846	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|P78875|TPP1_SCHPO	3.10e-215	96	926	27	817	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q9P4D3|TPS2_ZYGRO	3.73e-209	103	921	6	853	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|Q54NU9|TPSB_DICDI	2.87e-162	266	918	139	783	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q54K57|TPSA_DICDI	8.07e-162	219	914	64	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EEP82071.1.