CAZyme Information: EEP81896.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP81896.1
• CAZy Family: GT34
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		37003.74	4.8906

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476618:1871708-1872856(-)

Full Sequence      

MFCFLSVQAEGGQMDDVNFLYSRVNPDGTVRVGDQWADEQMPVDGTHGCIRAFAQLKDQH
AGLRVLLSIGGGGMGSQHFATVAGNPIALGNFVRSAKDLVDKFGLDGLDIDWEHPSDLEQ
GENYVNLLRVLREALPWSCYTLTTALPAGEWALRHINLSDAQCYVDLINLMTYDFSGPWA
PNSGHQSQLFSPAVPHHEAAEISCHSGVSYVLAQGVPPSKILLGIPAYGRAFPGTTDIGQ
PHCIRDGTNEDEIVFDYRDLPLPGCLEQQDDCLCAAYCVDRNMGFVSYDSTKTVGHKAKF
VKDMCLGGLFYWHIAADAVGKRSLVATGYSALHDLYSKP

Enzyme Prediction     

No EC number prediction in EEP81896.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	41	325	4.4e-64	0.8682432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	4.53e-82	17	317	29	334	Glyco_18 domain.
119365	GH18_chitinase	1.76e-80	13	317	25	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
395573	Glyco_hydro_18	8.02e-70	15	317	24	307	Glycosyl hydrolases family 18.
225862	ChiA	8.92e-69	2	333	70	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	6.48e-57	24	314	38	338	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACT90641.1|GH18	1.74e-190	12	335	59	382
QVM13509.1|GH18	1.74e-190	12	335	59	382
UBR88483.1|GH18	1.10e-126	12	335	53	371
QGA20822.1|GH18	2.67e-126	12	335	66	387
QKX53256.1|GH18	1.19e-125	12	335	69	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D2K_A	1.59e-58	13	327	28	358	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	4.42e-58	13	327	28	358	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	8.74e-58	13	327	28	358	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	2.62e-52	15	335	63	401	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
1WNO_A	5.37e-52	13	332	30	366	Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus],1WNO_B Crystal structure of a native chitinase from Aspergillus fumigatus YJ-407 [Aspergillus fumigatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q92222|CHIB_EMEND	5.69e-60	13	328	29	358	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|G5EAZ3|CHIB1_EMENI	5.69e-60	13	328	29	358	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|P0CB51|CHI1_COCPS	1.92e-57	13	327	63	393	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	1.92e-57	13	327	63	393	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|C5P230|CHI1_COCP7	2.07e-56	13	327	63	393	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.985747	0.014269

TMHMM  Annotations     

There is no transmembrane helices in EEP81896.1.