CAZyme Information: EEP81468.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP81468.1
• CAZy Family: GT22|GT22
• CAZyme Description: CBM21 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C4JXG0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	CH476618|CGC6	64209.01	7.1075

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476618:657276-659052(-)

Full Sequence      

MSMEPQPMLSSAEGATGRKELLSPRAELPLVVTDARRKPPSIDILPLRSSSVDGTILRQL
PEIEMHTPDQSDREDEESVVRPSMIRKKSGELVRPALRMKKRPSSMPGTPTFVKNVHFDV
QLEQVRHFLQLDMPVAVSAGSSPADEYDGDTEFPFGADSVPQTKPFQWEARVTNFPKEVN
ERSPVRLERMFLSSDNKYLVGIVAVANLAFHKHVVARFTLDHWKTVSEVEAEYDNNPRKD
NLLGANSNYDRFHFHIRLADLADLESKTMFVCIRYHVNGLEFWDNNDARNYHVNFSRKYK
WTNGSRGHACGPSNPFARNIRINPRPHSMPPLPSNMPFLPARSFQSPRDDGFSRPQQQVP
LSHADDDLLDTPTKRTKPPAQAFATRYDFGSSLSAAMQPGTLDLVQPGSDTNNRVTPLQD
MGGMLRTKLVSSPSTFSREPIRPSDILSEKPYHESPGYKELVDKYCFFETASSPTKARSR
PDDPQSTVDENQPNPHQELPPSESPLFSSVEASPTHEEPSMSLPFRSPRPQSPNDPSSSS
SSPLRFHSLRQTIPTGLLSQSPTPTPTPTAIRG

Enzyme Prediction     

No EC number prediction in EEP81468.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	183	293	4.1e-34	0.9719626168224299

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	1.66e-50	181	294	3	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	2.06e-06	207	293	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS57244.1|CBM21	3.88e-115	62	480	206	653
QSS61205.1|CBM21	7.49e-115	62	480	206	653
QGA19725.1|CBM21	8.60e-103	50	468	197	597
QKX59775.1|CBM21	6.17e-102	50	487	163	584
CAK37632.1|CBM21	3.08e-101	50	472	28	463

PDB Hits     

EEP81468.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5U2R5|PPR3C_RAT	1.05e-12	186	293	151	256	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	2.53e-12	186	293	151	256	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q9UQK1|PPR3C_HUMAN	1.09e-11	193	293	163	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
sp|Q0VCR4|PPR3C_BOVIN	8.51e-11	181	293	153	256	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1
sp|Q803M0|PPR3B_DANRE	5.26e-10	181	307	133	250	Protein phosphatase 1 regulatory subunit 3B OS=Danio rerio OX=7955 GN=ppp1r3b PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEP81468.1.