CAZyme Information: EEP81143.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP81143.1
• CAZy Family: GT2
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C4JU46]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	CH476617|CGC10	55242.36	9.7016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476617:3552912-3554363(+)

Full Sequence      

MDFSYFVRRNCPYFSRAIIKSILIAILGISIFALWFGMNSDRDNVHPILTQLIPAGHCAC
TTATIFNCTSCVDLAFKFKPTISPAPPLATPAWAFRYGQDDHNTALNTGQCQTAFPGLYE
DVDRAVRFWISRGGILKKSLNTVKLQNGMARAMIYNGNLFIIEARAAQEDHRRKILAVLS
SIHRALGNRAPNIEFIFSVEDKVEDVSGQGHPLWVLSRKATEKSVWLIPDFGFWAWGNPA
SNIGPYDQVVKRIEKFDLEDTMPWSSKTPRLVWRGKLSFAPKLRRRLLEVTRNKPWGDVK
EIVWSRKSHFISMEDHCKYMFIAHVEGMRVTSPAPEDQAMALNTYHPGRSFSSSFKYRQA
CRSVIIAHKLQHIQHHHYLLQSSGPNQNFVEVERDFSDLSDKVEELLANPEKAKRIANNN
VKIFRERYLTRAAEACYWRKLWEGWASVSQDSPISNNKSEPGLRFESFILLEGKTMLSFS
HQA

Enzyme Prediction     

No EC number prediction in EEP81143.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	190	448	1.2e-16	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	5.29e-15	189	446	1	250	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.31e-14	148	446	24	320	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
340831	GT4_PimA-like	0.010	389	443	313	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS76484.1|GT0	2.69e-193	13	481	7	456
BCR89787.1|GT0	3.68e-183	10	481	5	454
QMW31614.1|GT0	1.01e-182	31	480	31	459
UDD60541.1|GT0	1.01e-182	31	480	31	459
QRD90629.1|GT0	4.52e-181	31	480	142	570

PDB Hits     

EEP81143.1 has no PDB hit.

Swiss-Prot Hits     

EEP81143.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000002

TMHMM  Annotations     

Start	End
13	35