CAZyme Information: EEP79339.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP79339.1
• CAZy Family: GH71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	CH476616|CGC16	61292.24	9.3242

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476616:3518632-3520460(+)

Full Sequence      

MWRRTYLILLLIRVYFALSPSYLHPDENFQGPEVFAEQVYSYPAHLTWEFTSSQPIRSIF
PLWLAYGLPMTFLKWFWSEAGTGSTPPYLIYYVLRGTMFGLSFVLEDWAIHELIASPHNR
RQAVVLVASSYVTWTYQTHTFSNSLETLLVAWSLVVIQRILDNRQRSSVVACSILAFTTV
AGVFNRITFPAFIALPALQLVPHLLKKPFAFVSLVLSGAFFSFIAVYADTGFYNNARISL
RNVFQKPVITPLNNLLYNSDKSNLASHGLHPHYQHFLINAPQLLGPVFLLLVASIFSRSS
RSHFSLYNMRAVSALAGALLLSVFPHQEPRFLMPCIPLLLSCFRLPKSRFFLISWIIFNS
IMGILMGVYHQGGVIPTQLQIPTVLSRLYTGIDKVPIAGETANVFWWKTYSPPLWLLGDS
TKITIKTHDLMGIPGPDMLEKLDKSVMNCADGSVNKQGSINPTILVAPNSATFLDQYIHY
SDSKEPNGGNNLTLQLNRLWKYDKHLNLDDMDFGDDGIQTTLHRVLSRRGLNVWLVTRTC
D

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	5	416	6.2e-78	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	1.66e-51	5	415	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	5.16e-06	3	340	39	351	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11889.1|GT22	0.0	1	540	1	551
QSS72479.1|GT22	2.97e-236	1	538	1	617
QSS55894.1|GT22	1.20e-235	1	538	1	617
BCS03934.1|GT22	3.99e-232	1	539	1	534
BCS15543.1|GT22	3.99e-232	1	539	1	534

PDB Hits     

EEP79339.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UTP0|SMP3_ASPOR	1.50e-221	1	538	1	539	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	1.43e-215	1	541	1	547	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	1.05e-212	1	538	1	538	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q4I785|SMP3_GIBZE	8.30e-180	1	540	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	4.15e-83	10	448	13	427	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025026	0.974948	CS pos: 17-18. Pr: 0.9402

TMHMM  Annotations     

Start	End
167	189
209	228
275	297
307	324
350	372