CAZyme Information: EEP79031.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP79031.1
• CAZy Family: GH47
• CAZyme Description: Probable alpha/beta-glucosidase agdC [Source:UniProtKB/TrEMBL;Acc:C4JM19]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1583		178647.51	6.3904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476616:2647645-2654102(-)

Full Sequence      

MASRRAPVWSLTLVAIVILSCLVAPGLMVKHESFKTCSQSGFCKRNRALADSISDKGPSW
PSPYRLDPSSVTFKNGQLLGTVIKSTIKDGDVRLPLTVSFLKSGVARITIDEERRLNGDI
ELRHGSTVRKERYNEAAKWAVTGDLSPSPSAELESDPTNEFTKVIYGPDRTFKAVIKHSP
FGISFERDGETHIKLNDRGFLNVEHWRAKQEPSDETQNTDLELDDSTWWDESFGGNTDSK
PRGPESVGLDVTFPGYAHVFGIPEHADSMSLKETRGGEGQHTEPYRLYNSDVFEYELNSP
MTLYGAIPFMQAHRPGSTVGLLWLNAAETWVDIVKAKQSPNPLSLGAKGKTDTQTHWFSE
NGQLDVFVFLGPTPYDVTKSYGELTGFTQLPQHFAIAYHQCRWNYVTDEDVRDVDRKFDM
YQIPYDVIWLDIEYTDQKKYFTWDPHTFPDPIGMQKQLDDSERKLVYIIDPHIKNEANYP
IVDELKNKKFAVNNKDGSVYDGWCWPGSSHWVDCFNPAAIEWWKGLFKYDSFKGTQHNSF
VWNDMNEPSVFNGPETTMPKDNIHHGGWEHRDVHNINGLTFVNATYNALLERKKGEIRRP
FVLTRSFYVGSQRLGAMWTGDNQANWGHLAASLPMVLNNGIAGFPFAGADVGGFFGNPSK
ELLTRWYQTGIFYPFLRAHAHIDTRRREPYLSGEPYTSIITQALRVRYQLLPAWYTAFYQ
ASVDGTPIVRPQYYVHPSDEHGFAIDDQLYLGSTGLLAKPVVTEGATSVDIYIADDEKYY
DYFDYTIYQGAGKFHTVQAPLEKIPLLMQGGHIIPRKDRPRRSSGLMKFDPYTLVVVLDK
NGYAEGELYVDDGETFDYQSGAKIHRRFVFDKATLSSENLVTPGAKTAKYLRSMAEVYVE
KIIVVGAPNKWKSKETVQVEDGVRSQGFCLAPSSLRKNTRVFGGPANSTFASRERVRRRA
LTRTNWATGDRSPLCLLLGKGFSSDLFAAKEFGAFWSLFLPIIRLLRVHVVDDPAEIPES
SPVRSENQEEQGAIQFIMWLISVAMEYGAPLLYTVNYACCINFQVRFYPIDLLRQPRADR
LGVRVFYWFGAYYSFPLLLQAMMMVVVQILLLKVALDHRPQSPVDHTPFSGQLAGGQSEF
RRPYDFWQWRATRPYWTFLGYLSVSLFLIHVLIPPISHSKAYIEILGFAGLGVEAFLPVP
QILANQRSQSCKGFRFSVLMAWLLGDAMKMSYFFYNGSSVPWAFRICGMLQCVCDCYLGV
QYWMFGDGLPGRIDKAASSVAAGDDRWVALLDEISSLQSDIKLPECELGNLVLLVDGQDR
FLLMGNRRQFPDAHWIWKGAISKIRTLPLRRVWLNDLAQAVAFLESLNLAHGDLRPDNIL
IDGDRLRLSDFDCTAQIGAGFEACIPPYGRVLNSSESDPGGAGFLGPRTEQFALGSLYYL
INYGFEVYGDRCLTPDNPKQHGPKVVNLLQNMKFPTLDGDPVIDDIIDKCWHNNCATVEE
LAAHTEMLLDNGTNGGRTNAGPTSNSGWRKASTNRTKSKDDRYDDLLPEGFSPKKAFCED
LVKHGLLDLLSSGEPEHLGFSFD

Enzyme Prediction     

EC	3.2.1.20:27	3.2.1.84:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	367	814	3.9e-147	0.9953161592505855

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395838	Glyco_hydro_31	0.0	367	814	1	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	0.0	386	855	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
224418	YicI	0.0	156	908	59	763	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
269890	GH31_glucosidase_II_MalA	6.41e-133	386	725	1	339	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.
215408	PLN02763	1.94e-109	372	861	164	641	hydrolase, hydrolyzing O-glycosyl compounds

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11559.1|GH31	0.0	28	926	1	899
EAA58873.1|GH18|GH31	0.0	3	1262	4	1141
QSS53224.1|GH31	0.0	9	919	11	924
QSS76196.1|GH31	0.0	9	925	11	931
QSS58256.1|GH31	0.0	9	925	11	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DKZ_A	0.0	29	942	5	932	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DL0_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5DKX_A	0.0	29	942	5	932	Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5DKY_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495],5JQP_A Chain A, Alpha glucosidase-like protein [Thermochaetoides thermophila DSM 1495]
5F0E_A	6.54e-242	29	907	1	810	Murine endoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
7KRY_A	5.71e-241	12	907	17	896	Chain A, Neutral alpha-glucosidase AB [Mus musculus],7KRY_C Chain C, Neutral alpha-glucosidase AB [Mus musculus]
5IEF_A	3.17e-240	29	907	1	865	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9US55|GLU2A_SCHPO	8.16e-290	30	942	28	921	Glucosidase 2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gls2 PE=1 SV=1
sp|Q9FN05|PSL5_ARATH	4.90e-249	26	936	18	901	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
sp|Q8BHN3|GANAB_MOUSE	2.90e-240	2	907	8	897	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|B9F676|GLU2A_ORYSJ	4.64e-237	30	939	30	896	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
sp|Q4R4N7|GANAB_MACFA	7.36e-237	2	907	8	897	Neutral alpha-glucosidase AB OS=Macaca fascicularis OX=9541 GN=GANAB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001512	0.998467	CS pos: 28-29. Pr: 0.9547

TMHMM  Annotations     

Start	End
7	29
1043	1065
1085	1107
1155	1174
1181	1203
1213	1235
1242	1264