CAZyme Information: EEP79009.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP79009.1
• CAZy Family: GH47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
466		50509.17	4.5910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476616:2588530-2589985(+)

Full Sequence      

MRRFYAFAAVAAQLVDIGFAQTACTVTLTPSSTPVAADGYNVRVIAQGLRRPRSLQFDRE
GNLLVVQSSAGIWNFRLRDHGGTCLEVEDGVDLIDDSVKTRLNHGIALSPDEGKLYASDR
GTVYAWDYDAVARRVASSEPEVIIRGLDNSGHSTRTLHYSSGLGDYLVVVRGSAGNIDLE
CGDISTGHCQMKAFDMQQIPRGGYNFTADGIRLGWGMRNSVGIAEHPGTHGIWTVENTID
NIMRQGVDIHDDNPGEELNFHGTVNSTTGLNYGYPYCSAAWDVESIPNNTNFEVGTEFAL
DIEDGGRTDDYCAGIQAPRLTFEGHTAPLDIKFNGSSEAFISFHGSWNRDDPIGYRIARV
PFEDGEPMASRTDRQAAISVVTNEDISRCPGDCFRPVGMAFDRVGRLFFVSDSTGEIYVV
EKAQGSGPDAPPDAPPNSPPGEGKAASIKVGILNLVSAALLLWYVI

Enzyme Prediction     

No EC number prediction in EEP79009.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA12	24	420	4.7e-146	0.9950124688279302

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225044	YliI	2.05e-20	25	425	42	399	Glucose/arabinose dehydrogenase, beta-propeller fold [Carbohydrate transport and metabolism].
225921	YvrE	0.003	105	148	167	212	Sugar lactone lactonase YvrE [Carbohydrate transport and metabolism].
400653	SGL	0.004	75	151	118	184	SMP-30/Gluconolaconase/LRE-like region. This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species. These proteins include various enzymes, such as senescence marker protein 30 (SMP-30), gluconolactonase and luciferin-regenerating enzyme (LRE). SMP-30 is known to hydrolyze diisopropyl phosphorofluoridate in the liver, and has been noted as having sequence similarity, in the region described in this family, with PON1 and LRE.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM11534.1|AA12	2.32e-265	1	464	1	453
UKZ85601.1|AA12	7.26e-126	33	426	40	436
QDS74351.1|AA12	3.00e-124	17	426	18	430
UPK97414.1|AA12	1.36e-123	29	420	33	429
EHA48884.1|AA12	8.47e-123	23	426	28	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I1Q_A	2.82e-117	34	423	11	403	Iodide structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6H7T_A	2.91e-117	34	423	12	404	Native structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6I1T_A	3.01e-117	34	423	13	405	Calcium structure of Trichoderma reesei Carbohydrate-Active Enzymes Family AA12 [Trichoderma reesei RUT C-30]
6JT5_A	4.44e-61	37	422	18	410	Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_A Chain A, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea],6JWF_B Chain B, Extracellular PQQ-dependent sugar dehydrogenase [Coprinopsis cinerea]

Swiss-Prot Hits     

EEP79009.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000910	0.999048	CS pos: 20-21. Pr: 0.9588

TMHMM  Annotations     

There is no transmembrane helices in EEP79009.1.