CAZyme Information: EEP78539.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP78539.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	CH476616|CGC24	54538.97	7.4201

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476616:1184677-1186171(-)

Full Sequence      

MAAWITSPRKLRLIYFALVFVTVVVVIYSDAIDRLRFEFVVRKYSPCLPQIDESSGPSGP
IQNGDQSALPNCETFSTSPFARDGIQVVLKIGGAESRERLKSHVDGVTACIPNLLVVSDM
EQVVGPFRAHDVIRDVMNVLSREDRKTYQRQRENYCYRNDKEPKPTPGGWKLDKYKFFPM
VEYAYRQNPHAKWYVFTETDTFVIWDNLVQLLGRYNWTDPLYMGSPTPGRTLGQEWGGRK
SFFAYGGSGFVLSAAAMEILLQGQAGDNTDGSQLLTSKYRKMIRGDCCGDSVLGWVAAQH
RINVTGLWPMFDPAAVHDTPLGRTSWCQPAISFHRTKAPDTLKLWRWLQEKRKDGMSLGR
PILFSDLVDFLGILNVAFREDWKNTNAATFEKQFLDSFESCRAACHDHPECLQFSYHHRR
CHLVREIDLGNPAEPEGDGDSQHNRWLAGWDVEKIKRFQEAHPCGQVDWPAPSLDRIF

Enzyme Prediction     

No EC number prediction in EEP78539.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.89e-07	181	253	75	152	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.002	189	260	209	277	hypothetical protein; Provisional
250845	Galactosyl_T	0.006	175	261	65	164	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
394981	PAN_1	0.008	395	423	22	52	PAN domain. The PAN domain contains a conserved core of three disulphide bridges. In some members of the family there is an additional fourth disulphide bridge the links the N and C termini of the domain. The domain is found in diverse proteins, in some they mediate protein-protein interactions, in others they mediate protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS22284.1|GT31	5.14e-152	48	478	52	488
BCS10791.1|GT31	2.03e-102	4	478	13	481
BCR98451.1|GT31	2.03e-102	4	478	13	481
QRD83812.1|GT31	2.01e-101	72	478	83	477
QMW32351.1|GT31	2.01e-101	72	478	83	477

PDB Hits     

EEP78539.1 has no PDB hit.

Swiss-Prot Hits     

EEP78539.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000043

TMHMM  Annotations     

Start	End
13	32