CAZyme Information: EEP78185.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP78185.1
• CAZy Family: GH18
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		40322.45	8.3783

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476616:175325-176520(-)

Full Sequence      

MRRGALVFIIANIIVIAFLVNSVSTLLSLLFEDAADDAISRTELPAPNSTFIDQQEPLIP
KIIHQTYKNESIPAIWLEAQQTCLERHPDYEYKLWTDDKAEEFIATQYPWFLDTFKNYPY
PIQRADAIRYFVLAYYGGIYIDLDDGCNRRLDPLLVYPAWVRKTSPTGISNDIMGSVPQH
PFFRRVIDSLQTYNRHWVLPYITVMYSTGPLFLSVIWKEYMAGRPTGSERVRVMMADEYN
KHSWSFFTHHPGSSWHGKDARLIFWFFVFEDGWSLGPTHRPWIRARRYRRLLSMVGISTA
RYLLFEILPPVFSRPQPPIRRDLELSTFVFAVPQTWVIAGLPAATK

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	9.2e-24	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.33e-74	40	265	62	290	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.69e-24	73	155	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17906.1|GT32	7.72e-152	1	324	1	326
EAA57874.1|GT32	3.50e-150	1	265	1	265
AAP47108.1|GT32	3.50e-150	1	265	1	265
CAK42232.1|GT32	5.71e-150	1	265	1	265
BCS14035.1|GT32	8.10e-150	1	265	1	265

PDB Hits     

EEP78185.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	2.54e-100	1	263	1	267	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.98e-98	1	263	1	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	5.91e-83	56	265	79	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	5.93e-80	48	305	46	321	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.95e-55	59	309	64	319	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.473097	0.526888	CS pos: 26-27. Pr: 0.2672

TMHMM  Annotations     

Start	End
5	27