CAZyme Information: EEP77943.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP77943.1
• CAZy Family: GH18
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	CH476615|CGC18	50093.16	5.1139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:7429071-7430643(-)

Full Sequence      

MRLLSRRSHSVWASLLLLTLMGAQSLVSAIDLNLDDDASIKRAAKIAASGMTVFYTGHLP
GDVPGNLPAPYYWWEAGAMFGALIDYWYYTGDSTWNDITIQAMLHQASPSTNFEPRNQTK
SEGNDDQGFWGMAAMSAAERNFPNPPADQPQWLELAQGVFNSQAPRWDTTSCGGGLKWQF
FTLNRGYNYKNTISNGCFFNIASRLARYTRNQTYADWATKSWEWTERIGLITPTYQFYDG
TNDKLNCTELNRIQWTYNAGVHLLGAANMYNYTNGDKIWRDRVQGIVEGLRTFFFEETNI
MFEVACEGINTCDIDQRSFKAYLARWMAATTQLAPFTRDLIMPKLRASAAAAAKACTGGN
NGDTCGHKWTTGEFDGSIGVGEQMAAMEVFQSNLIAKVAPPVTESTGGTSKGDPSAGVRE
DPVPELRDLTTADRAGAWTITAVSIVTAIPGWS

Enzyme Prediction     

EC	3.2.1.101:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	38	404	9.3e-114	0.9608938547486033

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	0.0	39	387	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.49e-08	148	273	93	225	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA21543.1|GH76	1.72e-214	19	452	14	460
QSZ36627.1|GH76	5.76e-205	20	451	15	446
APA11655.1|GH76	1.34e-203	10	446	4	440
ATZ53339.1|GH76	1.91e-203	14	446	8	440
CCD44408.1|GH76	8.94e-202	14	446	8	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	2.19e-131	34	434	30	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6FLP9|DCW1_CANGA	1.10e-144	20	443	7	432	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.43e-144	17	443	9	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	5.22e-144	30	443	22	437	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	2.59e-134	25	423	15	413	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	9.93e-125	29	452	26	455	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000411	0.999560	CS pos: 29-30. Pr: 0.9674

TMHMM  Annotations     

There is no transmembrane helices in EEP77943.1.