CAZyme Information: EEP77315.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP77315.1
• CAZy Family: GH16
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
750		83760.68	5.3828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:5674526-5677282(+)

Full Sequence      

MSTETTRIILSLLQPQQTELVLPNGFQVQILDSLSEIACSPSSSVKKFQYAAFIREESIL
LVWHDELDRILVHAENVEGKLLSFICGTSGSVFAPSVNAHPLQRSSLTSPAESTHHVIST
WNKEATTPANQTFGSSDEEAAAPIESLDRPLALTSSIFVGLAMCLIIVLLLGFGVSNLLL
QVFIDGNYIRLALAATIPIFMLFSIFFVIVIFTDIFQAIGPIKTLKTNSRYYSALRPDLS
HAYSLGFKPPRLTIQMPVYTESLNGVIIPTVTSLKAAISHYESHGGSASIFINDDGLAYL
SEEQREERINFYHDNNIGWVARPKNNDNGYIRKGKFKKASNMNFALNVSNKVEDRLLEML
SDTLETTDMIEASQEEHLYQLALNEVLASDSRVWAAGDIRIGESILIVDSDTRVPVDCLL
YGAAEMFLSPEVAIVQHSTGVMQVSEDYFENGITFFTNLIYSAIRFAVGSGETAPFVGHN
AFLRWKAVQSVGKPDDGYVAYWSESHVSEDFDIALRLQIGGNIVRLASYHGDEFKEGVSL
TIYDELARWEKYAYGCNELVFNPIHTWLFRGPFTRLFMTFLWCKLPLSSKITILGYISSL
FLGLIVVFPLFGNVSLAIIRYRLGEKSLWGALVENFKWVPMMAIFFGGISFHLSLAILSQ
MFRINMEWGATAKEKDDSNFFKEMPKIFKGFKWMYAVIIPLIGGMVYLGCFAPRGWEITE
IAAVVPMAVTLSSHALLPLLLNPSLMIFNY

Enzyme Prediction     

No EC number prediction in EEP77315.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	405	607	6.7e-55	0.949238578680203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.84e-53	405	611	2	191	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.55e-09	382	510	69	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.87e-06	402	717	138	427	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
184755	hmsR	2.17e-04	365	609	117	352	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
224137	GT2	0.002	405	599	88	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	1	750	127	919
CAE7220538.1|GT0	2.13e-304	1	750	124	907
CBX97842.1|GT0	2.91e-301	1	750	124	904
QRD03074.1|GT0	1.38e-300	1	750	74	858
UNI18966.1|GT0	5.56e-294	9	750	126	905

PDB Hits     

EEP77315.1 has no PDB hit.

Swiss-Prot Hits     

EEP77315.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

Start	End
157	179
191	213
593	615
636	658
693	712
719	741