CAZyme Information: EEP77252.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP77252.1
• CAZy Family: GH13|GH13
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1083	CH476615|CGC13	119459.41	6.6346

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:5500673-5504764(-)

Full Sequence      

MSRDAFPDKVVHRNGNAVKIRIRASTNQSKGQVATSLVRFTGYGWDQVGTICSMASGVRS
TPKQLDRPSMLHELFTIPSSLPVMHSRCRRIQMFNPIVIIVWTVRALLLLSWLLGVQGIR
ESRLQELRAETEHMFYHGFENYMKYAFPEDELRPLTCGSLTRDRENPAHIELNDVLGNYS
LTLVDSLSTLAILSDAGSKTRNGWKAWTSFQDGVRDLVDLYGDGSNGPKGRGSRGRGFEV
DSKVQVFETVIRGVGGLLSAHLFAVGDLPIRGYNPPVNEASYAKLWDKTHTTPSHPGIRW
ANGFVYDGQLLRLATDLATRLLPAFYTPTGLPYPRVNLRYGVPFYPNSPVNGNSTRDTSH
SESAFPQEITETCSAGAGSLVLEFTVLSRLTGNGRFEELAKRAFWSVWVRRSDIGLIGAG
IDAESGKWVNSYTGIGAGIDSFFEYALKSHILLSEGQPPPFNTSGPFHELDNHYTPLPEE
AHSPDAFLRTWQQARNSIQHHLYRGSSYQHPHYIQGDIITGATRAFWMDSLSAYFPGLLT
LAGDLDKAAEAHLLTAALWTRYSALPERWSVATGEIEGGLTWWGGRPEFVESTYYLYQAT
EDPWYLYVGEMAMRDIKRRCWTKCGWAGLQDVRTGQLSDRMESFFLGETANAPMATRPTL
DLSFPPMPNSVLSSASLERVNDGIFVKSISGLRLGMIQDVPLFMEGGSAAVDGYRIQVIN
NIPLGKDEKVYVSRETTKVLEPTDPNFTQIEDLTMLDIIVDFKQPRISRNGSSTATRPPV
NTGKLAEDVRAPVEDSSNMKLAFSSFMSQVTSLLRDEVMSSSPGSAIFGQSISRASIPAL
TATGKGAVPLPDTEEATIPTPWATSTSNKKSAHSLPWSSIYLAGELCDAPLPSSVPKMHQ
VIVIKRGNCSFSQKLRNIPGFRPSRSSLQLVIVVSYPQHGDPDFSPDAKSKSAAKETVSP
FSEPIIELDESWLIRPLLDEIQVVADSIPRPHPISMVMALELESDCDAATYHISESHTGL
SKSQTAPDSPLVNPSSHDGFLAQTILGPLWAFLLEFGFIGTAPMILPCSRTGMAARATWR
ISF

Enzyme Prediction     

No EC number prediction in EEP77252.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	134	650	2.3e-128	0.9327354260089686

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	2.70e-116	134	649	1	423	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.02e-43	116	649	61	488	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS71303.1|GH47	0.0	84	998	1	1087
QSS56460.1|GH47	0.0	84	998	1	1087
QSS62002.1|GH47	0.0	134	998	1	1029
BCS05200.1|GH47	0.0	102	998	17	1058
BAE64371.1|GH47	0.0	84	1020	1	953

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	1.42e-23	127	634	13	388	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	7.62e-21	121	649	16	437	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	8.19e-21	121	649	14	435	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	1.53e-17	134	649	12	420	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.56e-17	134	649	12	420	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	2.35e-110	116	649	24	445	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q92611|EDEM1_HUMAN	2.87e-91	126	649	129	554	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|Q925U4|EDEM1_MOUSE	6.71e-91	126	649	124	549	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	3.89e-79	121	649	31	449	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
sp|P38888|MNL1_YEAST	7.68e-79	122	649	30	470	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000000

TMHMM  Annotations     

Start	End
94	116