CAZyme Information: EEP77178.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP77178.1
• CAZy Family: GH13
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
590		67610.43	7.8470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:5291397-5293222(+)

Full Sequence      

MRFQRVLVLLGLASLVAVTLFFLRTRYAPIIPVSQYPNKHNSPSPPVSHPSPAGADAHPI
AQLLSKSKSSWDDVRARQSKTLEEAVREYQRRYSLPPPPNFDVWFKFAKARGVELIDEYD
TIYESLLPFWGLQPKMIRDRAKEALGFDNSLIGVLIRNGAVSLVSGGGDSQEWKRKALEG
MMKQFVQYLPNMDLAFNIHDEPRVVIPSGDLQQLVSHALNVAIPQTANRSAHNAWTSPAD
LNGGDRIDEFKTTRFNRFAHQPTWTTSRSSCPMDTPARDLNEVAPDKIDAYLFGELGFVY
NTTAFSDICLSPSLRYTFGMFERPNAMSIVRDLFPIFAESKVSSFQDILYPSPWYWSGKV
TYEQGPNWDIKKDQMYWRGSTTGGFSRAGGWRRQHRQLFVKNINAVDDVKVLEKGETNWI
TKTVKRSDFKQLFNVSFSHVGQCDPEDCEAQKSYFDVVKPSPQDEAWEFKYLADVDGNAF
SGRFYALLRSRSLVYKLAVFREWHSEWLRPWVHYIPWSLKGDEHTESVRYFSMEEEGRQH
AARVAQESSGWAKKALKNDALEAWFFRLLLEYGRVVDDNRDTIGFSLDSP

Enzyme Prediction     

No EC number prediction in EEP77178.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	312	576	1.7e-74	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.72e-17	335	574	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	4.53e-06	318	574	96	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR83603.1|GT90	6.08e-267	1	587	1	600
QSS52524.1|GT90	2.55e-263	1	586	1	617
QSS64625.1|GT90	6.29e-263	1	586	131	742
QSS70518.1|GT90	1.28e-262	1	586	7	623
QGA13289.1|GT90	3.56e-261	1	585	1	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.18e-08	312	579	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	3.86e-52	52	581	147	661	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.02e-07	312	579	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.64e-06	312	579	123	373	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999857	0.000172

TMHMM  Annotations     

Start	End
7	24