CAZyme Information: EEP76790.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP76790.1
• CAZy Family: CE4
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
925	CH476615|CGC28	100282.19	6.4570

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:4235673-4238793(-)

Full Sequence      

MDGIGYRQMGQLFVMGFDGTSVNPQIRSLIEDYHLGSIILTAKNLKSAEETTKLVLELQT
IARDAGHSAPLMIGLDQENGGVNSLFDEIYIRQFPSSMGIAATKSKTLAREVAKATAQEL
SAVGVNWILGPVLDVLNNARSQPLGVRSIGDDAQEVSAYGVEFMKGYQEAGLVTCGKHFP
SYGNLDFLGNQSDVPVIKESLEQLSMNALVPFRNAITQGLDSMMVGGCAMSSAGMNVMHA
CLSEQVVDDLLRKDLEFKGVVVSECLEMEALSYNIGVGGGTVMAVKAGCDLILLCRSFSV
QQEAIDGLRLGVENGMISKERIQQSLKRVFDMKSRCTSWEKALNPPGISLLSKMQPSHTS
LSTRAYNNSITIVRDKKNLLPLTSTLESDEELLLLTPLIKPLPASAVSLSMSKSTRETVL
ATDAVSWDPSASIMSGESVFREFGRSLARHRNGRVLHTSYTANGVRPVHENLINRASGVI
VVTADSNRNLYQHGFTKHISMICDAQFAENGERRPKPLVVVAVSSPYDFATDQSVGTYVC
TYDFTETALQALVKILCGDLTASGSLPGTLSRNQKLQQSRQHWLAENWNEDRDANALDEL
LTAVREDGTNSQRSELAGVTSNTFLLRNPDVEEAHFVVRNSSTQALLGFCSTYFFKSTGT
GVIGALIVDPGRRKLSIGNSLHNRAIRSLMQRQGVRRFQLGSRLPGIYLGIPTGNPVERK
RLRQWFANLGWNTSLSRPVCTMVLRNLEKWTPPEGLTRSLTSAEVSYDLVYGPDYAEAIL
DHIKTNSRQGVMEIYKIALSSGSTSSGIIRAKRNDDGAILGSVVVYNGESPLAEFVPAVK
EARAVAGGISSAVISPSAGEYAILVQGLILLGIKQLRSQGASAVVLDCVDGDGNFDSLSA
MGFSVLHSFDEVTCDAATWNMLTSS

Enzyme Prediction     

No EC number prediction in EEP76790.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	68	293	3.3e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.38e-71	8	383	6	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	5.16e-63	10	329	7	313	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.73e-32	9	328	1	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.50e-13	94	382	114	415	Probable beta-xylosidase; Provisional
185053	PRK15098	3.30e-10	93	333	119	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	6	925	6	924
BCS15461.1|GH3	0.0	7	925	17	931
BCS03847.1|GH3	0.0	9	925	1	913
BAE65506.1|GH3	0.0	7	925	46	961
QMW48185.1|GH3	0.0	7	925	17	932

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	9.00e-90	7	825	11	769	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.02e-65	7	571	15	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.52e-43	20	381	71	446	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.99e-43	20	381	45	420	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.93e-43	20	381	75	450	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	7.81e-43	20	381	71	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	4.97e-34	20	571	49	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.24e-34	8	383	31	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	3.77e-28	19	305	12	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q6LJ30|NAGZ_PHOPR	1.18e-26	19	308	10	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEP76790.1.