CAZyme Information: EEP76668.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP76668.1
• CAZy Family: CBM21
• CAZyme Description: dolichyl-phosphate-mannose--protein mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	CH476615|CGC30	87775.80	9.3149

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:3841774-3844241(+)

Full Sequence      

MSSSPSSLRQRGGKKAGNLGTPERRSVSPAPPAVSQQPATKPSSEWDYKLALTVITILAF
VTRFYKINYPDQVVFDEVHFGKFASYYLQRTYFFDVHPPFAKLLFAFVGWLVGYDGHFLF
DNIGDSYVENKVPYVALRSLPATLGSLTVPLVFLIMWESGYSLPACVLSAGLVLFDNAHI
GEDRLILLDATLVISMTLSIYCYIRFHKLRHASFSRKWWKWLLLTGISLSCVISTKYVGL
FSFVTIGSAVLIDLWDLLNVNRRGGALTMVQFGQHFVSRAFGLIVIPFFFYLFWFQVHFA
VLNKSGPGDNFMSPEFQETLSDNAMAAKSVGVQYYDFITIRHRQTKTYLHSHPEKYPLRY
EDGRVSSQGQQVTGYPYNDTNNQWQILPSVSFPENDRLNHSVKNGDTIQLRHVGTDTILL
THDVASPFYPTNQEFTTVSHELADGKRHNDTLFQIKIEHGKAKEEFRTMASLFKLIHVPT
KVAMWTHTTPLPEWGFKQAEINGNKNAQESSNIWYAEDIPSLEPGNSRLIREPKQPKHMP
FLKKYLELQAAMFHHNNALTASHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGW
WIASSLLAIFAGVIGADQLSLRRGVDALEEIWGPGTRSRLYNSTGFFYLCWAAHYFPFYL
MGRQRFLHHYLPAHIASCLVTGALVEFLFNIDPINVENVVGAGGQGRRLGMRRVQMSRQT
MMATWAATVAILSAVIWGFWFFAPLTYGTPGLDVDGVKLRKWLSYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	54	299	9.9e-72	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	47	771	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	9.00e-86	54	303	2	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	3.89e-81	543	764	1	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	9.37e-20	350	497	13	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	6.23e-08	332	389	4	57	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW29154.1|GT39	0.0	1	771	1	775
QMW41228.1|GT39	0.0	1	771	1	775
QRD85448.1|GT39	0.0	1	771	1	775
UDD58942.1|GT39	0.0	1	771	1	775
EAA64589.1|GT39	0.0	1	771	1	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	5.79e-109	49	764	50	725	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	7.69e-102	54	767	70	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P28_A	1.39e-12	349	515	25	188	Crystal structure of the MIR domain (aa 337-532) of the S. cerevisiae mannosyltransferase Pmt2 [Saccharomyces cerevisiae]
6ZQP_A	1.95e-12	349	515	42	205	Structure of the Pmt2-MIR domain with bound ligands [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	3.68e-260	45	771	44	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	6.91e-256	21	764	33	768	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	1.17e-247	37	771	43	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|F1Q8R9|POMT2_DANRE	3.52e-115	52	751	71	735	Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
sp|Q8BGQ4|POMT2_MOUSE	6.56e-114	52	751	131	799	Protein O-mannosyl-transferase 2 OS=Mus musculus OX=10090 GN=Pomt2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999917	0.000076

TMHMM  Annotations     

Start	End
92	114
135	157
185	207
219	241
280	302
592	614
640	662
721	743