CAZyme Information: EEP75568.1

Basic Information

• Species: Uncinocarpus reesii
• Lineage: Ascomycota; Eurotiomycetes; ; Onygenaceae; Uncinocarpus; Uncinocarpus reesii
• CAZyme ID: EEP75568.1
• CAZy Family: AA3
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:C4JDZ0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1032		105487.55	4.0666

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ureesii1704	7856	336963	96	7760

• Gene Location: location=CH476615:731661-734871(-)

Full Sequence      

MGLTNILAAFIAVSSLFVQSLAFNPNSRTNLVVYWGQGYAQERLSYFCQKTNFDIIVLGF
INVFPDQGPGGWPGSNFGNQCADENYYTPDGTKTELLSGCRQIVEDIPICKALGKTILLS
LGGEARVPGAYKIKNARSALDFADWLWHAFGPRKLDWTGPRPFGDNVVDGFDFDIETGGS
FGYSIMVKRLRQRFLEDPLNRYYISAAPQCILPDAQLSDAIANSAFDFVFVQFYNNPSCS
VKKWLADPKSVTYTVADWAKSILRSGNPSAKLFIGLPGSEDSAKGYYIPPVGAYKLINTF
MKQYPNTIGGVMIWEATTSENNQISGKSYADIMKELLLVCDPSPPTSTITTTTATTSSMT
TSSISTTSATSSEVTTSSTMSTTKGSSTITTETTSSTESKTQDTTTTVTSASSSATQSTK
TTETTTTQTSESKTDSTESASTGTVSTGSASATIPTGSVSTGTTSATLPSETLSNTVSDS
ATVPTGSVSTDTTSNGSATQTLSNTASNSATASIETLPTQSQSASASDSSTIVPTVPSDS
ATVPTGSASTDTTSSEMPTQTLTNTPSGSATVSTDTATNSVPSQTLSNTPSTTVPTGSAS
TDTTTNGLPSQTLSNTPSDSATVPTGSASTDTTSNGVPSQTLSNTPSSSVTVPTGSASTD
TTSNNLPSQTLSNTPSATVPTGSASTDTATNGLPTQTLSNSESSGSLTVPTGMPSGSTTG
PSESVPTGTEPTESLPSNSATVPTGSASTDTLSNTRTPSAPPSGSSTVMTGTPSDSATAS
PPGPTVEPSQSTGITNTGTQPTQSGSIPTDSSTEVGNPSTLTTAPNPTITTGPSSSKTED
RTTVTTVITTSYVTICPTGFTTVTITYTTTYCPETVSPAPTQGPSPGSPAPPPEDGWTTI
VTVCPQCAPTPTTVTLTVPTRSAFLPAPTEALPVVTVLPVPEPPIKNVQPGDDEEGEAPG
VTATPTTVTKTLAYNNPGQPSGPAPVESGVEAQPTGGSGGPVEFEGGAMSVRGFDKMLVT
IGVAVLGLYLGL

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	29	332	7.2e-25	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	4.81e-115	29	335	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.39e-20	30	316	1	304	Glycosyl hydrolases family 18.
282904	Herpes_BLLF1	3.93e-11	437	784	459	828	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
119349	GH18_chitinase-like	4.39e-11	31	316	1	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
282904	Herpes_BLLF1	9.03e-10	449	836	429	804	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA92642.1|GH18|3.2.1.14	1.18e-171	1	352	1	352
ACC06929.1|GH18|3.2.1.14	1.18e-171	1	352	1	352
AAO61685.1|GH18	2.79e-119	12	358	12	353
QSS69866.1|GH18	1.74e-118	1	352	1	353
EAL85930.1|GH18	6.73e-118	12	358	12	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TX6_A	1.56e-118	28	338	1	309	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	8.17e-118	29	338	1	308	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	8.45e-118	29	338	2	309	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	3.35e-59	26	337	3	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	6.35e-45	31	327	3	266	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q1EAR5|CHI2_COCIM	5.29e-173	1	352	1	352	Endochitinase 2 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS2 PE=3 SV=2
sp|P54197|CHI2_COCP7	1.80e-172	1	352	1	352	Endochitinase 2 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS2 PE=3 SV=2
sp|Q873Y0|CHIA1_ASPFM	4.95e-120	12	358	12	353	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	1.20e-118	12	358	12	353	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|D4AT07|CHI1_ARTBC	1.32e-118	1	359	1	370	Probable endochitinase ARB_07371 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07371 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000187	0.999811	CS pos: 22-23. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in EEP75568.1.