CAZyme Information: EDK46551.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK46551.1
• CAZy Family: GT62
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	CH981530|CGC1	47321.19	7.2479

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981530:306874-308103(+)

Full Sequence      

MTKYRAQKNGTWRKFLISFSVLSIILITLALLNYSSANGAKDIHDVIKSLPNDKILGLSN
FLSSENSKNQDELLKQIEKMNSKHFSEQEQRLLKLEEQNRLILQELKVLKRPPLDSTMRE
KLAYLYSYDPEARFPAYIWQTWKHGLNDDRFDEKYRQGESQWAYKNPGFVHELFNDDTAH
TMVKYLYNQIPEIIETYEMLPEIILRMDFFKYLVLYAKGGVYADIDTYPLQPVPNWTPEN
VSPLDIGMIVAVDADSSSDKWRQESVRRLQFGQFVIQAKPGHPVLREVIAEIVETTRLKH
LESMSSTGNSNLKLTGNAQQKLMKISQWTGSAIWTEVIFKYFNDYILSSVFQKVTWKDFH
ELSTPKLVSDILVLPKSSFASDVDVANDGKITDPLAFVKHYAAKIWKGD

Enzyme Prediction     

No EC number prediction in EDK46551.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	156	239	6.9e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.35e-40	69	403	21	343	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.96e-16	162	243	11	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE39846.1|GT32	2.14e-207	1	407	23	429
CCG24586.1|GT32	1.13e-201	1	407	1	406
ABN66691.2|GT32	9.74e-185	35	407	31	400
CAG89506.2|GT32	1.73e-170	9	407	4	398
CCE86889.1|GT32	8.12e-169	7	407	5	398

PDB Hits     

EDK46551.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P47124|HOC1_YEAST	1.00e-102	7	407	6	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	1.34e-65	113	409	78	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|Q9UTR6|OCH1_SCHPO	2.97e-47	121	409	129	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P31755|OCH1_YEAST	6.10e-47	118	409	80	472	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.943086	0.056933

TMHMM  Annotations     

Start	End
12	34