CAZyme Information: EDK46032.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK46032.1
• CAZy Family: GT39
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	CH981529|CGC2	46770.26	9.1226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981529:139543-140763(-)

Full Sequence      

MVNLTAFIAIAVALRIGFFAFGLYQDAHMPVKYTDIDYLVFSDASKYVYNGMSPYMRETY
RYTPVLAWLLLPNNWSGVWCHYGKVVFMLGDLVTGYIITKLLSQLKPNQRKITEKRKLIY
ASIWLLNPMVITISTRGSSESVLTSMIMLSLYYLLSTSRENLVVSAIWLGIAIHFKIYPV
IYLPSILYYLSDKVETPLPGISSLKLNWKNITFLLVTCASFSTLTALMYLIYGQEFLDET
YLYHLTRLDHRHNFSIYNVLLYYKSAVLGSSPLSTGYDIEKLAFIPQLVISGIVIPLLLA
KQDLISCLFIQTFVFVAFNKVITSQYFIWFLIFLPHFLTRSNLATTRRTRGAIILLLWIG
SQACWLYNAYRLEFLGENTFDYAMLYSAVFFFLSNCICIREFIASV

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	133	403	2.6e-87	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.83e-84	1	391	5	404	GPI mannosyltransferase
252941	Mannosyl_trans	1.26e-66	133	403	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44265.1|GT50	1.38e-182	1	405	1	396
CCG23660.1|GT50	2.23e-179	1	405	1	397
AOW28981.1|GT50	1.05e-177	1	405	1	397
AAV03184.1|GT50	2.72e-177	1	405	28	424
CAX42079.1|GT50	5.82e-171	1	405	1	401

PDB Hits     

EDK46032.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AMR5|GPI14_CANAL	1.86e-178	1	405	1	397	GPI mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPI14 PE=3 SV=1
sp|Q6BHI9|GPI14_DEBHA	5.86e-157	3	403	5	407	GPI mannosyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GPI14 PE=3 SV=2
sp|P47088|GPI14_YEAST	4.82e-107	15	406	16	389	GPI mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI14 PE=1 SV=2
sp|Q75C82|GPI14_ASHGO	2.33e-103	15	403	16	381	GPI mannosyltransferase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=GPI14 PE=3 SV=1
sp|Q6CRE7|GPI14_KLULA	2.19e-102	8	380	9	361	GPI mannosyltransferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000001

TMHMM  Annotations     

Start	End
2	24
75	97
118	135
139	156
161	183
211	233
254	273
283	300
313	335
350	369
382	404