CAZyme Information: EDK44579.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK44579.1
• CAZy Family: GT1
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		61432.82	5.8403

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981526:1174780-1176363(+)

Full Sequence      

MRKELKYILWAHVALVIYLIYLSFDLITLLHDDTYSDALIDFELNPLKNSGQLNKPALIP
KIIHQTYKLENIPDIWKAGQQACIDLHEDYQYILWTDEMAREFISEEFPWFLKTWDNYKY
NIQRADAIRYFALYHYGGIYIDLDDGCEKKLDPLLTVPAFVRKTIPTGISNDVMGSVPNH
PFFLKAIESLKNYQRNWLVPYITIMISTGPLFLSVIWKQYKRWGVPEAGKVRILMPENYK
GYNNSFFAIAPGSSWHMGDANFIKSLANHLVLAVIGGCLIAVAILAIEYLFYSFIISTFF
KKFTAKIGNFFMWTITKILRFFNLDKFIESSEALKQYKLVGLGEDEERTFCAITEKFKQQ
EQLPLHVQQQHQQQQQQQQLLQLQDKDQQLHKQKHPHIAQDNQNKKNGINLMQFLKNSNV
KRRSRKDSNLPFNIEMMEQLAQDTTIVIADDTSSLPNTKQHHQQQQQQQQQQQKDGAQEH
IVYLSTNDDTDVDPDNETDQAFFSDGNNDADILANDEFNDDYNDNIV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	4.5e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.61e-76	1	297	10	320	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.42e-25	73	155	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG25834.1|GT32	3.53e-218	1	450	1	399
CCE44715.1|GT32	3.10e-217	1	450	1	399
AOW27901.1|GT32	4.29e-175	1	449	1	439
CAX44109.1|GT32	3.47e-173	1	332	1	332
ABN66494.2|GT32	1.42e-171	1	329	1	324

PDB Hits     

EDK44579.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	3.98e-132	1	304	1	300	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	8.43e-130	1	297	1	301	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	1.34e-84	47	293	70	316	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.97e-80	54	269	52	268	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	9.11e-53	51	260	59	266	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999967	0.000053

TMHMM  Annotations     

Start	End
7	29
197	216
270	292