CAZyme Information: EDK44558.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK44558.1
• CAZy Family: GH92
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	CH981526|CGC5	45203.11	5.8639

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981526:1113993-1115189(+)

Full Sequence      

MAPLENPNLEGYHVARQMWLEYYNPKAGTYIAKKKCSGCYNDEKFVVWAVSVADQAIVDA
ARIYPEFKPLIQPAIAIFEKYKNRSKKGFSAAEGGDNDIYYDDDAQVCSAMLTAYEVTGD
KTYLDQGRELTRFLMSGWNDNPNAVTKGGVHWHISKKLLNACTTAEVAKACLQCSKFIPL
EAQVYVDFAAKCIDWQIKVLQDPGDKLIMDGIGEDGDKPDAAKWSYNTGTTLSAAAHLYQ
ITKDQKWLKIATELAEAGINHNSFFYDRDFPNDKRYWRDPSYFNQLLIEGLADYLLYVGQ
DVPEGLAQRIHDEVRRHLIMFYEFMKDPRDGGYIQSFEPHNTYREVYDAKYHQWFGDGKG
WGLKGEDKDGEGNPQKCLMGLGSAARIFFQGARIVPKI

Enzyme Prediction     

No EC number prediction in EDK44558.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	13	304	1.1e-51	0.7681564245810056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.90e-33	35	293	24	290	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	5.18e-09	100	261	91	247	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44696.1|GH76	1.00e-256	4	398	7	403
CCG25815.1|GH76	7.84e-254	4	398	7	403
AOW28251.1|GH76	1.15e-230	3	398	5	402
CAG87426.1|GH76	2.50e-212	4	398	3	399
CCE73401.1|GH76	1.61e-203	3	398	2	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	9.36e-22	83	257	89	267	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	2.56e-20	83	270	213	409	Crystal Structure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4V1S_A	5.53e-11	98	251	139	290	Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
3K7X_A	6.04e-11	100	259	90	246	Chain A, Lin0763 protein [Listeria innocua]
6SHD_A	9.28e-08	98	314	131	341	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14131|MU191_SCHPO	2.67e-28	19	397	21	416	Meiotically up-regulated gene 191 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug191 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK44558.1.