CAZyme Information: EDK44182.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK44182.1
• CAZy Family: GH65
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
386	CH981526|CGC6	42848.71	4.1806

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981526:155229-156389(-)

Full Sequence      

MQLSLLIFLLNLLLIASALPTLYKRSFDAESAYQSALNATWSLFWNSQYDAFNLNDPACT
SEFSYAAVWDLAVVGKAIVDSGDVAKTEDIINSLYKFQNSAGWFTSLPGGSEIYTDDNAQ
VVWVFLAAYELTKNQQLLNTAVNLIHLIQTQWSAIGGVTWQKDETYVASISTVEAALAAV
KVYEQNGDESLLTFANSSLTWLDEHLTDPTDGFYYDGINRQTWQLNKGKLTYTVGVAIST
YSYLYKFTGDEAYLEKAIAKASATLQSTTFLSPNGAWNNQLCYVHLLFAGFADLITITGI
TQYTEAVTNQANFIYLYDQLTQGSYGWYGSDLSLYNNYVKSTGDTKSISYSYSADNYCST
NPTQPKRSALDDGSAAQIFYNVARIN

Enzyme Prediction     

No EC number prediction in EDK44182.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	335	2.9e-38	0.88268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	2.79e-19	68	297	35	294	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	4.31e-08	111	269	88	249	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
271200	LanM-like	0.005	124	292	501	650	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.
271198	LanC_like	0.008	121	277	57	202	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOW27992.1|GH0	3.85e-149	24	384	30	399
CCG26053.1|GH0	1.09e-142	25	386	23	385
AOW27980.1|GH0	3.47e-135	24	385	38	411
CCE44944.1|GH0	1.13e-132	10	386	1	385
AOW27993.1|GH0	5.85e-125	21	386	33	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	2.82e-15	114	311	116	320	Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	4.97e-12	113	280	132	304	Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6SHM_A	2.12e-11	119	280	136	305	An inactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.12e-11	126	280	146	305	Chain A, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
4C1S_A	4.79e-10	110	307	102	319	Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

EDK44182.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999760	CS pos: 18-19. Pr: 0.9689

TMHMM  Annotations     

There is no transmembrane helices in EDK44182.1.