CAZyme Information: EDK44031.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK44031.1
• CAZy Family: GH5
• CAZyme Description: chitin synthase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1146	CH981525|CGC10	129730.96	6.1411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981525:2326410-2329850(+)

Full Sequence      

MSRRLHKYTEEEDDLIQENGGLIEEDDDLFNDANEDEDFLHLPTQQHQQHQQQQQEQPYS
SIYLASNPFTPGAAYPLVSPFGGYQPYGIYTQQLRGSSSPSREHGHRDATGSSSSGTAYS
DDYKKLDDFDYGFDSDDESANMFRDSSPRRQKTVQFKSDDSGIKYPPIAYNPTVRTNTFE
LGSFGSVGNSGAFGDYDVDAEKKGKKKEGDDGMGAGMEYRGHGRNRSNLEVVSGDDYMIN
PLVDAAYDGEEDETGAAVVVDDDDDSDDMFDDDSLFSSDDADLIRRATTMRRRMTKKSSK
FLNGGGTLKKSKSRGSTITFDDEEFKKLAYTKTIKKAKLINGNYVIDAPAPRALLERYGD
EHTSKASEMKFMRYTAATCGPSNYTKLNYNLRQALYEPRRETEIMICITMYNEDENLLAR
TLKGVFENIADLTKRSDSTWGDDSWKKVVVCIVADGRLHLNKKTKVLLTALGVYQDGYAK
SKINDKSVKSHIYEYTSTVGIDTITDHQVNLTRNKTPVQFLFCLKEHNARKINSHRWCFQ
AFAPILNPKVIMLLDCGTKPSKDAFFYLWRSFKDENVAGACGEMRTSLGPGKKLLANPLV
AAQNFEYKISNILDKPMESVFGFISVLPGAFSAYRYEALLNVNGEGPLEKYFKGEYLHQN
SHIGGSSGAGAGAGGEGEEEDDEREIKERNFEEAGIFTSNMYLAEDRILCFELVAKRGHK
YRLRYVKEAKAETDVPEHIDEFVLQRRRWLNGSMFAAAYAVFHWTKIWRSNHSLFRKLFL
QLEFYYQLVTILVSWFSLASFFLVFRILTANLGALDMNFDVGRYLAVIFEWFYVGCVVVT
FVLAFGNSPRGTRKFYLVVTYIFAIMMAYMMFSAIFLAVHTATSIIDAHKDDFKVTMIFT
NQKFRDLVVSMVSTYILYFVGAFLYGQPSFMFTSFVQYVLLSPTYINVLNIYSFCNIHDV
SWGTKGVEAAKDLGAAKFIGADDENIVLVAPEVNHELNDVYLTNLESLKNLNAKNDAEEV
DKINAKKFKDDSYYAFIRTVTVLIWMLTNAILIAVVLRTMGVDIMTKKLSTNSDGSIAGN
SEIFLSIILWIVAGLAVFRFCGCVLYLIGSMYRPLKWKMRSGKEGKKRNKKKYDEMGEEG
VNYKLV

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	410	572	3.5e-67	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.12e-91	410	572	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	5.29e-80	406	756	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.70e-31	336	409	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	6.10e-28	521	900	115	421	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	8.03e-15	520	644	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE44069.1|GT2	0.0	141	1127	108	1024
CCG23479.1|GT2	0.0	102	1127	65	1014
AOW28121.1|GT2	0.0	150	1127	149	1097
CAX42595.1|GT2	0.0	150	1127	151	1100
AAO37822.1|GT2|2.4.1.16	0.0	150	1127	149	1097

PDB Hits     

EDK44031.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P30572|CHS2_CANAX	3.46e-271	315	1116	218	1002	Chitin synthase 2 OS=Candida albicans OX=5476 GN=CHS2 PE=2 SV=2
sp|P30601|CHS2_EXODE	2.31e-233	332	1111	184	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2
sp|P30583|CHSC_EMENI	5.52e-225	332	1113	175	916	Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chsC PE=3 SV=3
sp|P08004|CHS1_YEAST	4.11e-220	334	1115	375	1128	Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS1 PE=1 SV=2
sp|Q12564|CHSA_AMPQU	1.75e-217	332	1111	161	898	Chitin synthase A OS=Ampelomyces quisqualis OX=50730 GN=CHSA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000079	0.000001

TMHMM  Annotations     

Start	End
783	805
825	847
857	879
907	926
930	952
1034	1056
1087	1109