CAZyme Information: EDK43822.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK43822.1
• CAZy Family: GH37
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1562	CH981525|CGC2	178008.32	5.3767

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981525:1729164-1733852(-)

Full Sequence      

MVLWLTFFLPFFITFAASLHNDLPKVGGEVLLHVEAPWNDTDFKALLIESIAGFNESLYL
PALELIYGLGDSEEVDLANDKEVYESVITGLSIEQSDIDFINFNLVYKRFAPRVIAHYNH
YEQVLLKQNFNKQLLVHCEKDLFGEIVEKKNGEIPAWVSYNNEIYCSVSDLFALKTIRGG
GSNNRNSDSDRDINISISNDRKGHTLFDRVIGINKGAPLVQFYGDPSAESTQRFLSLLHQ
EAIAGKLQFVWRYVPLGSPKKRNFLAGYSCELVKLDTIGSEPNSSTLSLQKNFAEIANSS
TCVESTAITTTITTTTTTTAKKTKSETKTNLDTLNEIGYKLTSFVLFNKYSMAKVDVLRT
IVNNFPKFLYFLDKFPENYHVRKVKTKAIENENMGLLRDSIGLYINGSPIHHLELDVFKL
VEKIQQEQSIVENLVELGFDSKQAKLLIQKFALLSSVKQSQFDSGNTIMGNNDNRFMVFK
SLFRKSNALKGGVVFFNNIEKDQNYQDYQDNPYAAYLGPDSQTLKPNQIPPLRENVHDII
FAINLADKQQLKIMFAMSKLILDSGIPQQIGVLPLSGSSMDLDIANRFYHILKVLNPQEA
LAFLYKYLDDSDNFEKVFEKVDLEKNFNVNLNTIPEKYSIFKPSVIVNGVIYDLSLPTWQ
MSMSKQIAQDISSLKANLKQAPSSRGLKNILYNNAKARRNARISQNPRDSLYKLIGDDLL
EISHLFKKKELGQMNQIAATMWFVSDFSHEDSLKQFINLLKLIELGASIQVRVLNLGNTS
IFKELMKNLQQQQQQQQQQQQRYGNNVVDFSALTDSSLGQLYDVIRNGQLSTQRNETIVK
AVEHMQLPTQHSYMLLNSRYLRMDIVYSVNDLEELLEFEWKQRLNMIEDVVSAYPEAFHN
FDLIDFAHEMSKLGHKSINDWFDLLSSVVTKSFHVDDKTFVVDVNRFDFDSVDMSNSIEI
LPYTEKKTVDVLLIIDPMDESFSQKAINMIAAIESFSFVNIRILLQPGIIGNGGVMGSET
LPYKRFYRGIYPSSIPIFGTNGQWLLDTKPSAVYENLPFANYLLKTEYPEKWVVEGNGYF
PTNMDPDCFNPSLSNVYFNFKMTGLLVDGYARDIHTGRTPEQLQLELSSDNSKTDTLVMS
ALNYFQMKAPPGVSQSLSASSDHVLLSASRNKYDSNVAIEELQTFDVPVFDLSGTQLHVR
VDDTLSKAFLKRKQENDKLQVQNQKRKSKTRFDSNLNIFTTICKKLDESLVGKLIASVRK
YNPSADVTFWVLSNYASSTFKAMKLQLETEYNVTIEFVTYKWPNFVRRQLLKQKICQGYK
VLFLDVLFPQELENVVYMSPNLICRADLSTLVNLELYNAPYAFPSMCEDKENGDVDMFWK
HGYWHEILGKNGLNYHSSEMFVANLTRIRDLGIGNVLRSHYQKLSSDSQSLHILDQDLVN
NLQGRIKIETLSNVWGWTDKWCPKSTLQGAKIITYEENESDDERGSKGLVVSQEIPELKA
YEKKIKMLYQNAQNIIEISQRLDPKLGGTAGADEEEQAGDFVEEASDGEEGGWDDTDYHD
EL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1236	1481	9e-75	0.9758064516129032

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	6.40e-81	1237	1508	2	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.82e-70	1236	1473	1	235	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408199	Thioredoxin_12	2.93e-26	41	255	2	178	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408201	Thioredoxin_14	4.33e-26	483	703	3	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	1.11e-19	1236	1475	1	237	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG22175.1|GT24	0.0	32	1516	31	1408
CCE40308.1|GT24	0.0	28	1562	39	1453
CAC18923.1|GT24|2.4.1.-	0.0	32	1514	30	1412
AOW28327.1|GT24	0.0	32	1514	30	1412
ABN66217.2|GT24	2.58e-313	32	1512	34	1478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	6.51e-66	47	1505	28	1444	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	8.57e-66	47	1505	28	1444	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.13e-65	47	1505	28	1444	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	6.41e-57	47	1448	21	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	1.47e-56	968	1505	655	1210	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	8.42e-74	34	1514	26	1430	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	1.20e-62	214	1508	190	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	1.49e-59	207	1514	172	1513	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.76e-58	214	1508	190	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	4.00e-58	214	1508	190	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.153234	0.846721	CS pos: 18-19. Pr: 0.5125

TMHMM  Annotations     

There is no transmembrane helices in EDK43822.1.