CAZyme Information: EDK42789.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK42789.1
• CAZy Family: GT91
• CAZyme Description: glucose N-acetyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490		58084.91	9.1389

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981524:2558776-2560248(+)

Full Sequence      

MEQIQAVKSSRRSLYKNWEFKLAIFLIGYFLITNGIFSNTSYMLLLLLLLLRPLLLQKGL
GRHLKVIPEEIIDYYDQKTTLQNTEKLAYMQYATNYEYLNLAILNFVQLRKAQTQIPNLV
ILYDEILQFYDSDRWSDLFQVANYHGITMRPTLLIKSNYDDQLPWAASFTKLQVFVQDDF
DRIVYIDADSMFVNSSFVAGGKAINKMNGVSHIDELFKIPQEFDVALPQAYWLNHIVEGK
SPPKYTQPVIEIPTKRTHKLQMRKLVNELNKSQDWRILPLLVYEDHKFENFNDFFANHVM
VIKPSKDVYNELLKYVFNPWYWSLTNRKNVKKSSDYDMEILNKYLDTKLRKGAINVGILP
HRVYGVLTGEFGEEWHARFITEPQYLPFVKKRSNKGWDPVSIFSKVKLVHFSDSPIPKPW
EEERENANQESQGGKYYDTKRTFCKTSNLTEYHEKFPHFKPRLVEDCVSVDIWNWIRKKF
KESQKDLWFC

Enzyme Prediction     

No EC number prediction in EDK42789.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	5.41e-82	88	480	2	278	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
132996	Glyco_transf_8	1.21e-23	87	421	1	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
133018	GT8_Glycogenin	9.41e-08	88	234	2	126	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	1.35e-04	74	322	58	285	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG21314.1|GT8	3.12e-204	9	489	8	468
CCE43359.1|GT8	2.54e-203	16	489	17	468
AOW27523.1|GT8	3.48e-194	9	489	6	461
AAV04198.1|GT8	5.57e-189	19	489	9	454
ABN66322.2|GT8	2.86e-159	12	488	13	476

PDB Hits     

EDK42789.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59ZI3|GNT1_CANAL	6.18e-195	9	489	6	461	Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GNT1 PE=3 SV=1
sp|Q6BUZ2|GNT1_DEBHA	3.11e-118	17	488	13	462	Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=GNT1 PE=3 SV=2
sp|Q4HVS2|GNT1_GIBZE	4.86e-27	86	420	154	392	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q12096|GNT1_YEAST	4.84e-21	64	420	61	445	Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GNT1 PE=1 SV=1
sp|Q4WBL2|GNT1_ASPFU	3.00e-20	86	420	79	326	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000008

TMHMM  Annotations     

Start	End
20	42