CAZyme Information: EDK41905.1

Basic Information

• Species: Lodderomyces elongisporus
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Lodderomyces; Lodderomyces elongisporus
• CAZyme ID: EDK41905.1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1713	CH981524|CGC5	193477.58	5.0475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_LelongisporusNRRLYB-4239	5908	379508	109	5799

• Gene Location: location=CH981524:237732-242873(-)

Full Sequence      

MPLRDKVHLNFLSPVHSILGHLSGSTVVSEDEDATEDERDHNDDTIVHHNSGEEEQQQQQ
QQHRHGEKGHNTHDGQSINPKSKPDNDRAATPVQEARSEPLTKRSSTDDEEDTARPCGDA
SGADFFSSFINNTSLCSGFGSLNNLRKLNFEDFLQGKKNEDLSHDNLEEHKHPNLRKLRE
KWDDMKPDSITLPVSHKRSGSDYEHKAHPVYAQLKRKEEQEQEQGGKGSNTTTDDEMTSG
DDADEDGEDDQEEEEEEEEEEEEEEEKFLAKRLTPSHSKTSLIQTLPSDSPHPTPTSSKI
AATTRTKSTKTATATTEAATATTEAAAATSSSLSTSPTKTLSNEDASKTTSTSVISNITS
YSTIDSDFSELKVNEKSEKEKSEKEIKIEKHRIDDEARNRVEKQILDGDEQIPSEENLTS
LQKSVIQNLDPHSIREGVLIKVRQPHTDQEDHQKNDNKLTESKKRLRFLIAEKLQRTFHL
KDDDIFYGNYSSWLVKDVLLQGHMYLTKDALLYFAFLPKRYTIDATAEVNNMEDSSNIIM
KGNLGMKTGKLGDTTFVTPVTHKYWTILRPETMSIYSSSTDLYFPITVIDMRTCLYAEIA
DKEKYREAQLTTPGSRSANVASSGLNSPPSVTDTASELRKMLDEDVGATEDSVEVKSTNV
WIKLVTRKKTYRFQCDNLYSARQWCSNLTKTIFQLNNANLSGEVLVKIPIANIVDFRKKT
LFDEVDDDDIDPESNDIPLSLSIKYHTNHVVEKRKRDKIKDKLKNENDDVAEIFFLFPKN
GTELFNAFDKIMQRPTSSNRNESETSSKIFASLKRDKVELDTSISTLTPSSNFLVKAVIE
SNMPEPTPRTSEESALKRLGKSIARPRAFTKTSNTQNSIDLVTTDSLSDSSQLSLPIALS
EKSLKKLEITFETTMKDFKDATKRYEDKGQLLAAIDDIPLPSNEQNIDEKRNHSRLRKQI
KSFSTVGAKLSANPLHYRIKDKYFVQSEHEREVASKNFQKHFSLFNSQLVSSYYCHVLRT
LPVYGKLYVSDHEVCFRSLLPGVSTTMIIPMLDIAEITSDDTKLSYAGATIIVQGVDEMT
IEFSSSKSRDDFRETCLEILAKLHENEGFRPQPHQWGSNYNIELAKTRMEYTDSERRRLD
KDTHDDKRELHLAKQRVALSRIKMFEDRLNAASGLEVPIVLEDSPFFKTEMRPSTSYNIT
LLTIGSRGDVQPYIALGKGLQKEGHKVTIATHSEFKEWIEKYHIGFREIAGDPGELMSFM
VGHSAMSVSFLKDAQAKFKDWIKQLLSSSWKACQGADILIESPSAMAGIHIAEALAIPYF
RAFTMPWTRTRAYPQAFFVPEQKKGGSYNYLTHVIFENIFWKGTQGQINRWRVNELDLPK
TNLFRLQQTKVPFLYNVSPSVMPPATDFPSWVKVTGYWFLDEGGSDYEPPKELLEFMDQA
VADDKKIVYIGFGSIVVDDSASLTKAIVDAVIDADVRCILNKGWSDRMGNKDKNKIEVEL
PPEVYSSGSIPHDWLFPKVDAAVHHGGSGTTGATLKAGCPSIIKPFFGDQFFYATRIEDM
GVGIALRKLTKKSLASALVQVTEDLRIVEKAKKVSLQINHEFGVLAAIESIYTELEYSRN
LIAAKDIHNENYKRHHPDFKAQSEPATDSEEESEYGSDKDDDDDTDEEEGEGSSMDEVDD
VDAEDAEDADDYKEAREEADETTDDEVHHKKRG

Enzyme Prediction     

EC	2.4.1.173:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	1202	1610	7.8e-48	0.9633507853403142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.07e-72	1197	1611	1	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.21e-62	1199	1611	4	395	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
275403	PH-GRAM2_AGT26	2.00e-38	1006	1097	1	93	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 2. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
397255	Glyco_transf_28	9.80e-35	1199	1334	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
275402	PH-GRAM1_AGT26	1.47e-22	504	692	1	116	Autophagy-related protein 26/Sterol 3-beta-glucosyltransferase Pleckstrin homology (PH) domain, repeat 1. ATG26 (also called UGT51/UDP-glycosyltransferase 51), a member of the glycosyltransferase 28 family, resulting in the biosynthesis of sterol glucoside. ATG26 in decane metabolism and autophagy. There are 32 known autophagy-related (ATG) proteins, 17 are components of the core autophagic machinery essential for all autophagy-related pathways and 15 are the additional components required only for certain pathways or species. The core autophagic machinery includes 1) the ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and ATG27), 2) the phosphatidylinositol 3-kinase complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known about how the core machinery is adapted or modulated with additional components to accommodate the nonselective sequestration of bulk cytosol (autophagosome formation) or selective sequestration of specific cargos (Cvt vesicle, pexophagosome, or bacteria-containing autophagosome formation). The pexophagosome-specific additions include the ATG30-ATG11-ATG17 receptor-adaptors complex, the coiled-coil protein ATG25, and the sterol glucosyltransferase ATG26. ATG26 is necessary for the degradation of medium peroxisomes. It contains 2 GRAM domains and a single PH domain. PH domains are only found in eukaryotes. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCG20531.1|GT1	0.0	416	1658	346	1572
CCE41582.1|GT1	0.0	416	1643	344	1552
CAX39732.1|GT1	0.0	411	1650	239	1472
AOW30966.1|GT1	0.0	412	1650	236	1468
AAD29571.1|GT1|2.4.1.173	0.0	411	1650	237	1470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	1.70e-190	1179	1625	2	449	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	3.44e-190	1179	1625	22	469	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	4.70e-20	1199	1565	3	348	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.02e-18	1205	1565	9	331	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1PN3_A	1.84e-14	1205	1566	9	338	Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A950|ATG26_CANAL	0.0	412	1650	236	1468	Sterol 3-beta-glucosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATG26 PE=3 SV=2
sp|Q6BN88|ATG26_DEBHA	0.0	419	1658	202	1507	Sterol 3-beta-glucosyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=ATG26 PE=3 SV=2
sp|Q9Y751|ATG26_KOMPG	2.28e-273	470	1631	194	1194	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|A7KAK6|ATG26_PICAN	1.23e-271	470	1625	218	1213	Sterol 3-beta-glucosyltransferase OS=Pichia angusta OX=870730 GN=ATG26 PE=3 SV=1
sp|Q751Z4|ATG26_ASHGO	1.63e-253	450	1625	166	1204	Sterol 3-beta-glucosyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ATG26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK41905.1.