CAZyme Information: EDK40411.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK40411.2
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606	CH408159|CGC2	69859.48	6.6188

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408159:1042505-1044325(+)

Full Sequence      

MTALIKDGFWRERIKTVSTNTLPSMYKLLHETGRWDFFDFNWKEGIKPHIFWDSDIAKFM
EAVCFALKYTEEGDARNLQYKSWMDDITRMILKAQQPDGYLNSYFTQVKPTERFKNVAEE
HELYCCGHLIEAAVAYYEATGSKVLIECLCRYLDLICETFGDESGKLHGYPGHQEIELAL
VKLTKIVPEPRYKKLLDYFIEQRGYQNGKFYDDEVRARGLDPDTYRPRGDYDHLPGVHYD
SHWPAPRSYWYLQADVPVREAHEVKGHAVRQVYFLTAVQAVASLKNDDGLRNSVKRLFRN
MIDKKFYIHGGIGAIARWEGFGEDHDLRWDGYSETCASIGLVFLCEKMLLDHLDREVALV
MERALYNDVLGGVSINGESYFYDQPIIGERGLKRSSWFSVSCCPPNVARLLNSLEKYAYS
LSSDSVAVHLYIGAEIKNDHINMKLESEYPQKGRFKISLKTSKPISLAVRAPNHFKCSNT
SFTERNGYLHFAPKVWDEVIDLEFDLKIEVIVPDDKVEANRGHLAVQRGPFVYALQKSGV
QGDVSLSQLHIKRGQEFTEKLETIRDTKYISLSTTISGVVCKFVPYFVTGNEHPGEDFRM
WIKESQ

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	5	534	1.8e-152	0.9942748091603053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	6.73e-117	8	606	21	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	3.26e-100	5	534	4	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ46475.1|GH127	1.39e-130	5	605	19	632
BBH85646.1|GH127	7.32e-130	5	605	17	630
UOQ45426.1|GH127	9.54e-125	5	604	19	632
BDG43667.1|GH127	2.16e-123	5	604	19	633
BDG47586.1|GH127	2.16e-123	5	604	19	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.84e-112	5	604	18	647	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.45e-108	5	604	18	647	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	4.93e-81	5	602	17	623	The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	5.21e-75	50	544	72	576	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	6.53e-75	50	544	72	576	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	2.68e-74	50	544	72	576	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK40411.2.