CAZyme Information: EDK40223.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK40223.2
• CAZy Family: GT33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		91167.44	6.4502

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408159:683110-685551(-)

Full Sequence      

MADYKAFPGPRQEGPAQFGDAKLSGRVIDVMASLPATVNFEKDHIKVEAARGNSALYSSF
FYLQQHTEWETHLVGWGGAPGGLSDELDKSQEEARKKDATAALQEACGKNVHPVWAPSSS
GSKPKWMQYADDVLWPVFHYIMPQPSDGRAEHEAWRDYVRLNEIMFNKVKELYKPGDLIW
VHDYHLLLLPQLLRMEFPDAAIGLFVHIPFPSSEYFRGISKRSQVLDGMLGANVVAFQSQ
SFSRHFVSCCARVLGHEVAAGIVMAYGMNIAVDCLPIGIDVDRIEHDAFSDKVEQKVKAL
RQVYAGKAIIVGRDRLDSVRGVVQKLEAYETFLEMYPEWRNRVVLIQVSSKPQAHSIGQT
RSVAQSNSVQRKVEEMVSRINNIYGSLNYSPVVHYQMRVDRDEYLALLRAADVAVVASVR
DGMNTTALEYVVCQRHTAAPLVLSEFTGTSTVLQDASLVNPWDAVGVARALHDSLTLSET
ERAKQEQQLYSQVTSNTVQQWTNAFIGRLVKHTSEDASHHTHHTPALDRPLLYKCYQKAS
KRIFFFDYDGTLVPIVRDPAAAIPSSRLSSLIDALAEDPKNQIWVISGRDQAFLGKWLGD
KKIGLSAEHGCFMRDFGRTEWINLAAETDMSWQEVVESCFRRYTEKTPGTNIEKKKVALT
WHYRRADPELGVFQAEKCQKELEETVATRYDVEVMAGKANIEVRPRFVNKGEIVKKLMAL
HDDHNPPEFVLCLGDDRTDEDMFRSLLEVQEQWHKSDKPKLSPNGSYGIFPVAVGPASKE
TVATAHLSDPSQVLETLGLLTGHVSLEDTAGCS

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	21	509	5.4e-157	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	26	509	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
184712	PRK14501	0.0	25	803	1	726	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
395781	Glyco_transf_20	7.39e-159	76	509	48	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	2.25e-136	24	518	14	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	9.05e-126	134	808	157	849	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN67480.2|GT20	0.0	22	811	26	833
CAX44578.1|GT20	0.0	6	811	14	839
QFZ39249.1|GT20	0.0	15	811	21	843
QFZ33578.1|GT20	0.0	15	811	21	843
QFZ27114.1|GT20	0.0	15	811	21	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.65e-198	6	513	14	527	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5DXI_A	6.31e-134	523	805	4	302	Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314],5DXI_B Structure of C. albicans Trehalose-6-phosphate phosphatase C-terminal domain [Candida albicans SC5314]
5DXN_A	1.25e-97	524	800	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 2 [Aspergillus fumigatus Af293],5DXO_A Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293],5DXO_B Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 3 [Aspergillus fumigatus Af293]
5DXL_A	3.02e-94	524	800	3	269	Structure of Aspergillus fumigatus trehalose-6-phosphate phosphatase crystal form 1 [Aspergillus fumigatus Af293]
5HVO_A	8.36e-85	26	514	12	479	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P31688|TPS2_YEAST	3.58e-268	16	811	5	857	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	3.29e-259	26	811	10	864	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|P78875|TPP1_SCHPO	2.61e-203	15	797	27	809	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|O14145|TPS2_SCHPO	8.99e-162	2	797	64	846	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1
sp|Q54K57|TPSA_DICDI	2.16e-149	23	793	14	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK40223.2.