CAZyme Information: EDK39818.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK39818.2
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824		91475.72	5.9569

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408158:1204052-1206526(-)

Full Sequence      

MNVDSVLQQLTLDEKIHILSGVDFWHTYAIPRLNVPSIRTSDGPNGVRGTKFFDSVPAAC
FPCGTGLAATFNKELLYEVGEMMGVEARHKGAHVLLGPTTNMQRGPLGGRGFESFSEDPH
LAGLVSAAIINGIQSKKVAATIKHYVANDLEHERKASDSVMTERALREIYLEPFRLALKH
SNPKALMTSYNKVNGIHVSHHKHLLLDILRDEWKYDGTIMSDWWGTYTSKEAIEAGLDLE
MPGPTRFRDNATMGHMVQTRELHINDIDHRVKNILKLISYASQSGIPENGKEDTLNNTKE
TAAFLRKISNESIVLLKNEGMLPLKSSEKIAVIGPNAKYAAYCGGGSAALKAYYTVTPYE
GICSKLDHQPPYTVGAYAHQKLPPLAQRLVNPVTHEVGYNMKFYHDVDRKSQFDEINTSD
SRIFLADYHHPDLHSNLYYIDVEGNLKVEESGAYEFGVAVWGTAKLFINDKLVIDNSVNQ
VRGPSFTNLGTIEVKDTIILEAGIDYNLKIEFGSIPTSTIKSEGSPPFGGGGIQFGFAKV
IDADEEIANAVSIAKSVDKVVLCIGLNQEWESEGYDRPSMELPGRTNDLVRAVLAENPNT
IVVNQSGTPVEFPWIKKAPAVIQAWYGGNETGNSIADVLFGDFNPCGKLSLTWPLKVQDN
PTFLNFRTEKGRVLYGEDVFIGYRYYEKLQKQVAFPFGFGLSYSEFVFSNLKVNTQDNLK
VTVDVENVGQVAGSETVQVYVAPQNSTIIRPVKELKGFEKVYLKPGEKVTVHLDMAMSDS
ISFFDEYQKAWCAEKGDYQVQVGTSSDDIELIGEFKVAATKYWK

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	242	1.3e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.93e-76	61	810	120	758	beta-glucosidase BglX.
224389	BglX	2.26e-64	23	338	48	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.80e-58	313	683	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.15e-51	5	771	55	738	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.08e-34	61	277	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85284.2|GH3	0.0	2	823	72	901
CDR44766.1|GH3	0.0	2	823	5	836
CCE84110.1|GH3	0.0	2	823	5	831
CCE85141.1|GH3	0.0	2	823	5	831
SGZ46718.1|GH3	0.0	1	823	4	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	0.0	2	824	5	843	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.22e-316	2	824	5	843	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.48e-140	1	820	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.23e-121	2	812	4	658	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.12e-101	3	824	4	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07337|BGLS_KLUMA	3.61e-317	2	824	5	843	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	3.04e-294	1	823	4	836	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q2U8Y5|BGLI_ASPOR	1.41e-292	1	823	4	836	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	3.24e-291	1	823	4	836	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	2.53e-290	1	823	4	835	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999862	0.000160

TMHMM  Annotations     

There is no transmembrane helices in EDK39818.2.