CAZyme Information: EDK39507.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK39507.2
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	CH408158|CGC2	38755.40	4.6985

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408158:605392-606528(+)

Full Sequence      

MKSSILSLIAVATVAMAAPLEGHRHHKHDLHKRDVVTKVVYVNGQGQTITPSASAAPTEA
ASSTVATIVSSSAAAAASSSGSPASQAGSSETSSSTGSSSGGSGGISGDLSAFSGPNNKF
EDGVHKCSSLPTGQGVISVDWISGLNGGWTSIMNENGDTSSTCQDGYYCSYACQAGMSKT
QWPSEQPSNGISVGGLYCKNGYLYKTNSDSDYLCSWGEQTATFVSEISKDVAICRTDYPG
SENMNIPTLLEGGGKAPVSVVDSASYYTWKGGKTSTQYYVNNAGVSVEDGCIWGTDGSGV
GNWAPVVLGAGMTNGKTYLSLIPNPNNKDAPNYNIKIVGADGANVVGDCKYEDGSYNGNG
SDGCTVTVTSGSANFVFY

Enzyme Prediction     

No EC number prediction in EDK39507.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	76	378	7.3e-127	0.9735973597359736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	1.31e-140	122	365	1	244	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG86368.1|GH132	3.16e-192	1	378	1	383
EAZ62917.1|GH132	1.02e-175	1	378	1	360
CCE42652.1|GH132	4.57e-173	1	378	1	384
CCG23148.1|GH132	1.19e-171	1	378	1	387
AOW26995.1|GH132	1.14e-170	6	378	4	372

PDB Hits     

EDK39507.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AKU5|UTH1_CANAL	2.03e-171	6	378	4	372	Secreted beta-glucosidase SIM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SIM1 PE=1 SV=1
sp|P40472|SIM1_YEAST	5.22e-130	106	378	205	475	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	9.16e-129	1	378	1	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1
sp|B5VMJ0|UTH1_YEAS6	9.16e-129	1	378	1	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain AWRI1631) OX=545124 GN=UTH1 PE=3 SV=2
sp|A7A003|UTH1_YEAS7	1.84e-128	120	378	106	362	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=UTH1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999723	CS pos: 17-18. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in EDK39507.2.