CAZyme Information: EDK39455.1

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK39455.1
• CAZy Family: GT15
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	CH408158|CGC6	37115.15	5.2690

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408158:514958-516040(-)

Full Sequence      

MLFKSLVSAATVALVAAVPLQHQHHEHKRDVKVVTQTTVVIAGANGDVTTAVPKVSLSTA
SVSVDPTTVIPQGQPSGFTNPSSFETGTASATGSASSQPSGGAGSSGAKGITYSPYSDDG
GCKSSSQIASEIQQLSGYNIIRLYGVDCDQVNAVMSAKSDSQKIFAGIYDVANIESGVST
LSSAVKANGGWDHVHTVSVGNELVNGGQASVSQIGEYVSTAKSALKAAGYTGPVVSVDTF
IAIINNPGLCKYSDYMAINAHAFFDGHVTAEQAGDWVLLQIQRVADACGSDKSVFVTETG
WPSKGDSNGVAVPSKSNQKSAVDSIVGSCGNDVTLFTAFNDLWKADGPYNAEKYWGILSN

Enzyme Prediction     

No EC number prediction in EDK39455.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	110	359	8.3e-26	0.9581993569131833

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.59e-96	58	360	8	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.49e-05	229	359	152	298	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN67223.1|GH17	1.64e-155	1	360	1	369
CAX44189.1|GH17	5.53e-150	1	360	1	373
CAG86316.1|GH17	7.58e-150	1	360	1	372
AAV03539.1|GH17	6.88e-140	1	360	32	409
CAC19886.1|GH17	4.06e-139	1	360	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	9.33e-09	110	360	39	284	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	1.62e-138	1	360	1	378	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q04951|SCW10_YEAST	2.51e-120	108	360	136	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|P53334|SCW4_YEAST	4.48e-115	109	360	134	385	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|P53189|SCW11_YEAST	6.16e-54	109	358	282	538	Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW11 PE=1 SV=1
sp|Q0CEX9|BTGE_ASPTN	3.30e-46	110	358	304	555	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000329	0.999671	CS pos: 29-30. Pr: 0.5904

TMHMM  Annotations     

There is no transmembrane helices in EDK39455.1.