CAZyme Information: EDK38776.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK38776.2
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
858	CH408157|CGC5	95785.35	6.3799

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408157:1015513-1018089(-)

Full Sequence      

MQPWIYKAAASRQFPKKMARKMDVEALLDQLTLEEKISLLAGKDFWHTVPIPRLDIPSIR
VSDGPNGIRGTKFFNAIPSNCFPCGTGLAATFNKELLHEVGKLMGKEAIMKGAHVILGPT
CNIVRSPLGGRSFESYSEDPVLSGHAASYIIQGIQSEKVLACLKHFVCNDLEDNRKGIDV
LVTDRAVREIYLKPFQIALRDADPKSLMTSYNKINGVHVSQSQEYLQNILRREWKYDGMT
MSDWFGTYSIKESLDAGLNLEMPGPTRYRQEIQTAHKVNCNEIHEDVITENARRVLNAVR
LAQEIGIKDDAEELANDTKEASQLLRKSGGESLVLLKNNDILPLPVKASSTIKKIAVIGP
NAKAAQDSGGGSASMTTRYKITPYEGIKAKLEEAGNSIELEYAMGATLDKTLPDVATITE
YNGKPGLMAKFYKHAPGTADRELFHELPLQTSKVFLPDFYHEKLEKGQLLYYIDIEGTFT
PDVSSTFEFGCSCLGTAQVFVDEKLLVDNKTKQEYGDAFFLGMGTREEVSEIKLEKGKTY
NIRVEFGTSPTYTLPCIHKEAGGVFFGFREKVDPQDMIKRAVEVAKDSDRVILCLGLSKE
WESEGFDRPDMDIPGYTTQLVDQVCEVNKNVIVVNQSGSPVAMPWIDKIQGLVHAWYGGN
ELGNAIADVLFGTVNPSGKLSMTFPKAIEDNPSFVNFTSDHGRVLYGEDVYVGYRWYEKT
KRDVLFPFGFGLSYTTFEVSGLKVQHKKDQIVVEVNVKNTGSVAGAEIVQAYIHHVRPSI
PRPVKELKDFAKVFLKKGESKKVSMTFSVREATSYWNEYKNKWCSEKGDYEVLVGTSSAD
TPLKDKFTIESTEYWLGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	51	263	1e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.05e-89	1	841	15	757	beta-glucosidase BglX.
224389	BglX	4.02e-65	43	393	47	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.63e-56	333	714	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	3.03e-38	7	818	23	753	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	5.12e-32	82	298	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN65244.1|GH3	0.0	20	858	11	851
CAG90292.2|GH3	0.0	20	858	8	850
SGZ55088.1|GH3	0.0	21	858	3	844
SGZ54931.1|GH3	0.0	21	858	3	844
QFZ41967.1|GH3	0.0	21	858	3	844

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.27e-273	21	858	3	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.86e-268	21	858	3	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.74e-147	22	852	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.03e-129	28	840	9	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.50e-112	24	849	4	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	5.03e-289	21	858	3	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	5.76e-288	21	858	3	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|B8NDE2|BGLI_ASPFN	3.28e-287	21	858	3	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q9P6J6|BGLS_SCHPO	1.36e-284	23	858	5	832	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	1.35e-283	21	858	3	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK38776.2.