CAZyme Information: EDK38289.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK38289.2
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
452	CH408157|CGC9	47660.27	5.2066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408157:160002-161360(-)

Full Sequence      

MRGQGASCSTTAAAIKRVAAADFYILLMKLVSILAFATSTLAASSCNPLKATGCPGNVAL
ATSIKEDFAESSKYFPIIKSEAQASYGSDGLTLSIKKRFDNPSFKSSFYIMFGKVEVVMQ
AAEGQGIVSSFYLQSDDLDEIDIEMLGGDDTQFQSNFFSKGNVQTYDRGEFHTVTPNPLE
NFHTYTIDWSKGSLTWSLDGQVVRTLLPNNPQGYPQTPMYIMGGIWAGGDSSNEPGTIEW
AGGPTTYGPTYSMHIKSLIVTDYSTGDKYVYSNQSGSWQSIEAENGKVNGRQNQADADFK
ALQSGKSVEKEETSSSSRSSSTSSTSSSSSSSSSSTSSSSSSSSSLSSSSSSSESSSTFS
SEKSSSSKLSSTISSSSSTKIYPKYVVTSKSIPTVSANESTHNSTSAAHTSTPQTSLAAQ
TSSSISNSSSSTSNNAAIIGISPLVFLPLLLI

Enzyme Prediction     

EC	2.4.1.-:3	3.2.1.39:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	89	243	2.1e-70	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	6.23e-106	85	264	20	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.30e-63	83	242	5	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	1.80e-29	76	261	24	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	8.51e-26	83	252	33	203	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
225182	BglS	2.94e-23	105	246	111	256	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG90860.2|GH16_18	1.09e-121	44	311	18	285
QFZ29704.1|GH16_18	3.06e-120	36	308	12	282
QFZ41048.1|GH16_18	3.06e-120	36	308	12	282
QFZ52394.1|GH16_18	3.06e-120	36	308	12	282
QFZ46729.1|GH16_18	3.06e-120	36	308	12	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.18e-73	44	282	2	243	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
1MAC_A	1.50e-17	90	254	48	204	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	1.56e-17	90	254	50	206	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
1U0A_A	9.94e-17	90	254	50	206	Chain A, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]
1CPM_A	9.94e-17	99	288	1	185	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53301|CRH1_YEAST	3.38e-112	44	314	38	308	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	3.34e-107	43	312	21	291	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|D4ALQ5|CRH11_ARTBC	2.51e-73	35	289	12	264	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	1.94e-70	44	282	23	264	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|Q5AK54|CRH12_CANAL	3.67e-67	46	286	43	285	Extracellular glycosidase CRH12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025094	0.974873	CS pos: 42-43. Pr: 0.8729

TMHMM  Annotations     

Start	End
21	43