CAZyme Information: EDK38238.1

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK38238.1
• CAZy Family: GH5
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
385		44514.15	5.2914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408157:73529-74686(-)

Full Sequence      

MTFYDLNHSKGSKDGWQRDERVLFCVPLRDAAAHLPMFFSHMKNLTYPHNLIDLAFLVSD
SSDDTMGALLKHLNEVQSSPNVASRFGEIEIFEKDFGQAIGQGFSDRHGFAAQGPRRKLM
ARARNWLWTVAIKPHHSFVYWRDADVETVPTTILEDLMHHDKDIIVPNVWRPLPDWLGNQ
QPYDLNSWQESDGGLQLAEQLDEDACIVEGYVEYQTWRPHLAYLRDPYGDPEVEMELDGI
GGVSILTRASVFRSGAHFPAFSFEKHAETEAFGKLSKRMGYSVVGLPHYVIWHIYEPSSD
DLKHMEWMALEEVRQKEEAKIRKVYDKVWDVAFMDVQDEWKQERKNLFKNTDLSNARKIQ
VNWPGVDDWMLEAAGDNKKLANFNP

Enzyme Prediction     

No EC number prediction in EDK38238.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	2	262	2.8e-124	0.9776119402985075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	4.35e-158	2	262	3	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85616.2|GT62	1.07e-255	1	385	60	444
CCE78624.1|GT62	1.04e-252	1	385	48	431
ABN66521.2|GT62	1.70e-251	1	385	75	458
CCE78036.1|GT62	4.06e-250	1	385	48	431
AOW27845.1|GT62	1.04e-249	1	385	45	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	1.64e-58	1	296	6	302	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	1.86e-209	1	376	62	439	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	1.16e-152	4	320	80	402	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|Q00314|VAN1_CANAX	1.96e-131	1	316	76	441	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P23642|VAN1_YEAST	1.21e-128	4	317	175	535	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|P53697|MNN9_CANAL	9.12e-65	1	296	73	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK38238.1.