CAZyme Information: EDK38195.1

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK38195.1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
559		61769.59	6.1340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408156:1959672-1961351(-)

Full Sequence      

MSKNFYVEEILQQLTLDEKISLLAGRDFWHTVPVKRLNIPSIRTSDGPNGVRGTRFFNGV
KSACFPCGTALASTFNKELLNESGKLMGEEAKHKGAHILLGPTTNMQRGPLGGRGFESFS
EDPYLAGMVSAAIVNGVQSEHVAATIKHYVGNDLEHERNASDSIVTPRAMREIYLEPFRL
AVKHANPKAFMTGYNKVNGEHVSQSKLYIDEILRKEWNWNGLVMSDWFGTYTTNTSIENG
LDLEMPGPTRFRTQAAVGHMIQTRELHINDLNARVRNVLEIIKYALDSGIPEDCPEDEKN
NTEETAKHLREVAGESIVLLKNEGILPLQKNEKIAVIGPNAKIAAYCGGGSASLRAYYTV
TPYEGITKKLGKEPPYTTGAHSHKTLPDMGRITKNPVTGGMGLNMKFFHEPPTEKTRTQF
DEVDIDTSQAFLADYYNKNLKGNLFWADIEGEFEVDESGEHEFGLTVWGSAQLFVNNKLV
VDNTKDQVGGDAFFNLGTIEQKGTIKLEKGANNKIRVEFGSAPTSTIKTQDSVDFGGGGA
VRFGFAQIIDPQEENRQGS

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	246	3e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.06e-67	9	373	33	390	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.45e-35	32	281	59	316	Glycosyl hydrolase family 3 N terminal domain.
185053	PRK15098	7.60e-35	3	371	34	451	beta-glucosidase BglX.
178629	PLN03080	1.17e-24	14	350	60	439	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.71e-18	317	389	1	73	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCE84110.1|GH3	1.97e-250	5	554	4	553
CCE85141.1|GH3	1.97e-250	5	554	4	553
CAG85284.2|GH3	6.89e-250	5	554	71	621
CDR47499.1|GH3	1.88e-249	1	554	1	556
CDR44766.1|GH3	3.73e-244	4	554	3	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.52e-189	1	556	1	565	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.13e-183	5	556	4	565	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.79e-79	7	371	5	371	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.13e-68	7	490	4	514	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.93e-67	7	490	4	514	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	3.98e-193	7	553	6	549	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	2.25e-192	7	553	6	549	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	1.75e-191	5	553	4	549	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	2.55e-191	7	553	6	549	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	6.98e-191	7	553	6	549	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000004

TMHMM  Annotations     

There is no transmembrane helices in EDK38195.1.