CAZyme Information: EDK37632.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK37632.2
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	CH408156|CGC11	40294.93	9.3008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408156:963883-964935(+)

Full Sequence      

MKKEVKYIIWGHVALVLFLVWYTFDLITLLHDDSFQDALLDVELNPTDGTVDKPMIIPKI
IHQTYKTTDIPAVWKAGQQACVDLHPDYQYILWTDEMAREFIAEEYPWFLSTWDSYPYPI
QRADAIRYFALVHFGGVYIDLDDGCERKLDPLLTVPAFVRKTLPTGVSNDVMGAVPRHPF
FLKVLDSLKPYKKNWLVPYITIMYTTGPLFLSVIWKQYKRWGVPEAGKVRILMPKDYKTH
SYSFFAIAPGSSWHLDDAKFIKSLANHIGLAVAGGFLIAGFIFFLEFLLYTVVTSGSFKK
YAKRFNVFTLINNFRIRSSASRIKKRSRKDSNLPPPIHIEKDGDVTSSMV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	74	153	4e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.21e-77	1	284	10	315	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	2.18e-25	71	153	1	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG85453.1|GT32	4.80e-215	1	342	1	344
ABN66494.2|GT32	5.04e-196	1	350	1	351
CCE85744.1|GT32	3.79e-193	1	341	1	341
CCE86854.1|GT32	6.26e-192	1	341	1	341
QRG37334.1|GT32	9.03e-183	1	345	1	337

PDB Hits     

EDK37632.2 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	4.68e-146	1	332	1	350	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.36e-142	1	334	1	357	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.40e-89	34	305	60	327	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	8.36e-84	57	277	57	278	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	1.58e-51	33	259	42	267	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000043

TMHMM  Annotations     

Start	End
7	29
195	214
268	290