CAZyme Information: EDK37371.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK37371.2
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	CH408156|CGC6	49160.45	5.8842

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408156:508485-509744(-)

Full Sequence      

MPGWRSTFYIAAIAVALYLLYPETLSYKSRFGSTKKSPELLAKAHDAALDGSPKLASNSY
LEVRFPRINRNQIGKENATLVMLARNSDLEGALKSMRSLEDRFNRHYRYPWVFMNEVPFD
DDFIEHTSLMASGKTYYELIPDEDWEPPAFIDENKLQHNLRTAEANGVIYGGLRSYRNMC
HFNSGHFYKQKKLLEFEWYFRVEPDVEYMCDFQYDPFTLLRKNGKKYGFVIAIQEYEDTI
PTLWETVEEFMEKYPQYLHPNNALNFITSHETSLNLGIPLVGQNKYNLCHFWSNFEIGNL
DFFRGEAYEAYFNHLDQAGGFYYERWGDAPVHTIGLSLLLDKNEIHHFDDIGYYHPPYMA
CPASLDVRASKRCICQARDLEDKMSRMSIDVDYYSCLSRWWRYGSGKRFLNEIDYTAAN

Enzyme Prediction     

EC	2.4.1.131:20	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT15	75	356	2.7e-122	0.9926739926739927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227353	KTR1	1.56e-160	9	412	18	398	Mannosyltransferase [Carbohydrate transport and metabolism].
396385	Glyco_transf_15	2.34e-121	71	357	38	313	Glycolipid 2-alpha-mannosyltransferase. This is a family of alpha-1,2 mannosyl-transferases involved in N-linked and O-linked glycosylation of proteins. Some of the enzymes in this family have been shown to be involved in O- and N-linked glycan modifications in the Golgi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABN66544.2|GT15	4.30e-202	1	419	1	419
CAX43696.1|GT15	2.95e-200	6	415	2	407
AAO11801.1|GT15	9.77e-199	9	415	8	407
AOW27482.1|GT15	1.14e-197	9	415	77	476
CAG89062.1|GT15	4.11e-197	51	419	77	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1S4N_A	1.72e-100	71	375	22	314	Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4N_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p [Saccharomyces cerevisiae],1S4O_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4O_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: binary complex with GDP/Mn [Saccharomyces cerevisiae],1S4P_A Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae],1S4P_B Crystal structure of yeast alpha1,2-mannosyltransferase Kre2p/Mnt1p: ternary complex with GDP/Mn and methyl-alpha-mannoside acceptor [Saccharomyces cerevisiae]
7BOO_A	8.42e-91	69	364	60	352	Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOO_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, apo form [Aspergillus fumigatus A1163],7BOP_A Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_B Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_C Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_D Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_E Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163],7BOP_F Crystal Structure of Core-mannan synthase A (CmsA/Ktr4) from Aspergillus fumigatus, Mn/GDP-form [Aspergillus fumigatus A1163]
5A07_A	2.67e-76	26	410	24	431	X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A07_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae in complex with GDP [Saccharomyces cerevisiae S288C],5A08_A X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C],5A08_B X-ray structure of the mannosyltransferase Ktr4p from S. cerevisiae [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26725|YUR1_YEAST	6.55e-138	54	412	65	423	Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YUR1 PE=1 SV=1
sp|P33550|KTR2_YEAST	9.62e-137	54	412	69	423	Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR2 PE=3 SV=1
sp|O74546|OMH3_SCHPO	7.40e-109	77	400	65	372	O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=omh3 PE=3 SV=1
sp|P38130|KTR3_YEAST	4.82e-108	75	376	85	375	Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR3 PE=1 SV=1
sp|P27810|KTR1_YEAST	9.62e-108	75	375	70	359	Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.591370	0.408629

TMHMM  Annotations     

There is no transmembrane helices in EDK37371.2.