CAZyme Information: EDK36290.1

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK36290.1
• CAZy Family: AA6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	CH408155|CGC1	55406.62	6.5965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408155:699950-701383(+)

Full Sequence      

MPGFLKTKGTKIVDGDGFVTVLTGAATGGHLNMENFITGYPGHETEHKKVMKSKMGAEKF
EYFFDKFYEYFWTEEDAKFFKSLGFNCLRIPFNHRHFLDDEGDLFQINRKGFARLDALVN
TCAKHGIYTILDLHTAPGGQNQDWHCDSGIHKSLFWEFKVFQDAIVNLWVEIAKYYKDNI
WVAGYNPLNEPAVADHSKLVDFYNRIDKDVRAVDPNHILFLDGNTYAMDFRQFPSKTIPN
CVYAIHDYAQYGFPNLEGTLYKGSEEERAKLKSQYERKIEYMKAHNVPVWNGEWGPVYAS
KVRGDSDPETINRARYNVAKDQLAVYKKGDPSGDKTPISWSIWLYKDIGYQGLTYVSPDS
KWYKVLGDFLIKKKHLGLDRWGNDIDPKYAELYANLVDHFKANMPEKHQKALYPHNWSVT
DYVYRVTKDMLFSQYAQHEFAELFAGLSFEDLDEMAASFKFENVLKRDELNEILRAY

Enzyme Prediction     

EC	3.2.1.4:2	3.2.1.37:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	48	348	1.8e-121	0.9965034965034965

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	4.18e-25	69	315	22	257	Cellulase (glycosyl hydrolase family 5).
225344	BglC	6.95e-15	56	391	58	399	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
225343	BglB	4.87e-04	67	134	57	121	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG90288.1|GH5_22	1.02e-271	3	477	2	476
QFZ36284.1|GH5_22	2.37e-268	3	477	2	477
QFZ41968.1|GH5_22	2.37e-268	3	477	2	477
QFZ47644.1|GH5_22	2.37e-268	3	477	2	477
QFZ30616.1|GH5_22	2.37e-268	3	477	2	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	3.53e-10	59	281	16	225	Chain A, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	8.38e-10	59	281	16	225	Chain A, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
6KDD_A	1.78e-07	81	295	51	262	endoglucanase [Fervidobacterium pennivorans DSM 9078]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W8QRE4|XYL5_PHACH	4.24e-158	4	474	3	465	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
sp|A3DJ77|GUNC_ACET2	1.02e-09	59	281	16	225	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
sp|P23340|GUNC_CLOSF	1.02e-09	59	281	16	225	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
sp|P0C2S3|GUNC_ACETH	1.82e-09	59	281	16	225	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
sp|P16169|GUNA_RUMFL	1.31e-08	71	297	30	262	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK36290.1.