CAZyme Information: EDK36116.2

Basic Information

• Species: Meyerozyma guilliermondii
• Lineage: Ascomycota; Saccharomycetes; ; Debaryomycetaceae; Meyerozyma; Meyerozyma guilliermondii
• CAZyme ID: EDK36116.2
• CAZy Family: AA4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	CH408155|CGC12	46283.19	6.1380

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_MguilliermondiiATCC6260	6062	294746	142	5920

• Gene Location: location=CH408155:370128-371351(+)

Full Sequence      

MSDFRELKQKLYSESVVAKIWGVASSKLNDANPPTEMPEYSFFDDKGYTYRDMEYWTCGF
FPGSLYALRERSVKYSDSFPGSKLHPLKLEHAAKWWAESLKIEAPRTDTHDLGFIIAPVF
IREHELTGSKESLDILVTAANALASRFDETVGCIRSWDTAVNKRYNYSDTQKDYLVIIDN
MCNLDLLYYVAKKTGDLRLSSIATRHAETTLKHHFREDWSCYHVLNYNKRNGEVIAKFTN
QGFADESAWSRGQSWAVMGYADAYAFTKQKKFLDAAISLADYFLGQLPEDGVPAWDFKAP
NKEVRDVSAGMIASLGMLSIYESTKDKKYLDSALKLIDNCTRFAYNEESKLHEGGKVTLG
NFDTILHASTINNNPDAPKQLANHGLVYADYYFLTIGNKLLDLEVFN

Enzyme Prediction     

No EC number prediction in EDK36116.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	50	395	9.4e-102	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224250	YyaL	1.98e-04	255	366	415	521	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
271199	LanC_SerThrkinase	0.002	252	338	87	173	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.
226678	YesR	0.006	249	355	36	121	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87553.1|GH88	6.76e-182	5	403	11	407
SGZ49613.1|GH88	6.30e-170	2	407	5	407
SGZ47225.1|GH88	8.94e-170	2	407	5	407
CAR65600.1|GH88	4.04e-168	7	407	10	408
CAG86543.1|GH88	4.98e-168	6	407	13	414

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.02e-51	56	407	73	400	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.07e-32	108	317	111	314	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.13e-32	108	317	112	315	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	2.06e-31	108	317	112	315	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]
3VXD_A	2.06e-31	108	317	112	315	Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_B Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_C Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316],3VXD_D Crystal structure of unsaturated glucuronyl hydrolase mutant D115N from Streptcoccus agalactiae [Streptococcus agalactiae NEM316]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	1.46e-55	56	394	77	388	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	6.77e-36	108	334	113	337	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	2.31e-34	36	394	48	382	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	2.12e-31	108	317	112	315	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	7.18e-30	48	404	34	365	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EDK36116.2.