CAZyme Information: EAW25100.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW25100.1
• CAZy Family: PL1
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		55341.93	4.9993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027685:1311192-1312649(+)

Full Sequence      

MLSKFEEKPRPAMGASWMWKRRVLRFSVALLLVAGFTYELWPGVEYMPEEPPTIIQNITI
TSGVKCEPDFDVLRRLDVRKLSQYERREMIVARSSEPELPIRQRLNIPFLQQQSSSDEAR
RLGLPSQDDCYIKSPVTVEVPPSPANVDASHIDFGVATTLERLNDSLDAFTHWAGYTRTR
IFALVEPDERVEEVQAKADSLGINLFVTQSEEEYQTRYFSLVAHLAKNMRPRTRWACVID
DDTFFLSMAALVDALAEYDDTKPMYIGGVSESVSQIGIFGLMGFGGAGVFLSRPLVQQLS
NHDVFEACQAMPHTGDRRISLCIYQHTETKLTVDNRLRQLDMRGDVSGFFESGREPPLSV
HHWKSWFQADMAKLSVITNLCGDKCFLRQWQFSDGWTLTNGFSIAKYSTEIDLDDRTMEV
SWVGDNGAVDESFMHALGPLRPKDMGKFSYILEDSVFLGNQVRQWYVHRDAEKGDQIIEL
IWKMA

Enzyme Prediction     

No EC number prediction in EAW25100.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	5.51e-12	231	362	209	341	hypothetical protein; Provisional
367085	Fringe	4.32e-08	147	300	1	160	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	5.25e-06	282	362	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACP98530.1|GT31	2.27e-316	42	485	60	503
QMW40633.1|GT31	1.30e-248	1	483	1	483
QRD83076.1|GT31	7.49e-248	1	483	1	483
QMW28562.1|GT31	7.49e-248	1	483	1	483
BAE58287.1|GT31	3.04e-247	1	483	1	483

PDB Hits     

EAW25100.1 has no PDB hit.

Swiss-Prot Hits     

EAW25100.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000011

TMHMM  Annotations     

There is no transmembrane helices in EAW25100.1.