CAZyme Information: EAW24735.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW24735.1
• CAZy Family: GT4
• CAZyme Description: cutinase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	DS027685|CGC5	22340.62	8.2240

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027685:259300-260048(+)

Full Sequence      

MNLRLLTLALAGLAAASPVAIQERQFSSGNELRDGACKPITFIFARASTEPGLLGMSTGP
AVCNNLKAAKPGQVACQGVGPAYTADLGSNALPENTSPAAINEAVDLFKQAASKCPDTQI
VAGGYSQGTAVMDGSIKRLPDEVKEKIKGVVLFGYTRNAQERGQIANFPKDKVKIYCAMG
DLVCDGTLIVTAAHFTYGANTGDAARFLLGKLSTA

Enzyme Prediction     

EC	3.1.1.74:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	36	212	1e-43	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	6.98e-65	36	212	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35358.1|CE5	1.51e-127	1	215	1	215
QMW47420.1|CE5	1.51e-127	1	215	1	215
UDD64461.1|CE5	1.51e-127	1	215	1	215
BAE65128.1|CE5	2.65e-126	1	212	1	212
QRD91768.1|CE5	2.40e-125	1	215	46	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GBS_A	2.05e-107	17	212	1	196	Crystal structure of Aspergillus oryzae cutinase [Aspergillus oryzae]
3QPD_A	8.87e-102	27	212	2	187	Structure of Aspergillus oryzae cutinase expressed in Pichia pastoris, crystallized in the presence of Paraoxon [Aspergillus oryzae]
5X88_A	3.52e-78	17	213	1	199	Chain A, cutinase [Malbranchea cinnamomea]
3DCN_A	3.40e-59	19	212	2	200	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
1CUY_A	2.35e-57	36	212	30	207	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CVT3|CUTI2_NEOFI	1.34e-152	1	215	1	215	Probable cutinase 2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=NFIA_102190 PE=3 SV=1
sp|B0Y537|CUTI2_ASPFC	7.38e-143	1	213	1	213	Probable cutinase 2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=AFUB_071270 PE=3 SV=1
sp|Q4WQV2|CUTI2_ASPFU	7.38e-143	1	213	1	213	Probable cutinase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=AFUA_4G14120 PE=3 SV=1
sp|B8NBB2|CUTI2_ASPFN	2.67e-128	1	215	1	215	Probable cutinase 2 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_044870 PE=3 SV=2
sp|Q2TZY7|CUTI2_ASPOR	4.72e-127	1	212	1	212	Probable cutinase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090011000665 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999671	CS pos: 24-25. Pr: 0.6029

TMHMM  Annotations     

There is no transmembrane helices in EAW24735.1.