CAZyme Information: EAW24647.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW24647.1
• CAZy Family: GT39
• CAZyme Description: glycosyl transferase family 8 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	DS027685|CGC14	39024.23	6.3123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027685:46386-47490(-)

Full Sequence      

MIRKFVLVLLTALTVYIIVSTNACLRELLHLRLKKNHRCESFPCDGHFALTTFLAGDYDG
KEGDHDDDDTYFVAARVLTYQLLHAPRTRLQSPTPFIVLVTKDVRESKRQRLRDDGASVV
EVDQMEHNISISEPRWLQTITKLRVFDPTAVPYSTVLYLDTDIVLIRPIDSIFSDPSSKI
TDPLDYAKGNDVVQDRLPEKYTMAASPESGKLDHPYPYLDTEQRDSYFNSGFFIYSPSTQ
LFEHYMSLLKGSEAWYRGFPDQDLLNYAHHLEGPMLWQKLHFSWHLNWPNNNDLNSGMAA
LHAKWWKGDFVSPSVKEYALSRRWEMEGYWMGRASGCG

Enzyme Prediction     

No EC number prediction in EAW24647.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	68	292	2e-27	0.7704280155642024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	4.76e-26	48	305	1	193	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
227884	Gnt1	5.13e-18	69	306	81	336	Alpha-N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
215090	PLN00176	2.59e-09	49	277	24	242	galactinol synthase
279798	Glyco_transf_8	6.53e-09	68	286	7	217	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
133037	GT8_A4GalT_like	2.28e-07	68	284	8	207	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMQ52339.1|GT8	1.24e-59	49	336	59	349
SMR57542.1|GT8	1.28e-59	49	336	60	350
SMR55167.1|GT8	1.80e-59	49	336	60	350
SMY25981.1|GT8	5.03e-59	49	336	60	350
SMR55403.1|GT8	5.81e-57	48	333	39	317

PDB Hits     

EAW24647.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O43062|YGT9_SCHPO	3.63e-18	67	309	87	348	Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4C3.09 PE=4 SV=1
sp|O22893|GOLS1_ARATH	5.29e-07	89	266	55	228	Galactinol synthase 1 OS=Arabidopsis thaliana OX=3702 GN=GOLS1 PE=1 SV=1
sp|Q9FXB2|GOLS2_ARATH	9.14e-07	89	266	47	220	Galactinol synthase 2 OS=Arabidopsis thaliana OX=3702 GN=GOLS2 PE=1 SV=1
sp|Q9FFA1|GOLS5_ARATH	1.62e-06	49	266	23	220	Galactinol synthase 5 OS=Arabidopsis thaliana OX=3702 GN=GOLS5 PE=2 SV=1
sp|O22693|GOLS4_ARATH	3.86e-06	89	266	48	221	Galactinol synthase 4 OS=Arabidopsis thaliana OX=3702 GN=GOLS4 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004742	0.995233	CS pos: 23-24. Pr: 0.9607

TMHMM  Annotations     

Start	End
5	24