CAZyme Information: EAW24577.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW24577.1
• CAZy Family: GT34
• CAZyme Description: glycosyl hydrolase family 76 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	DS027686|CGC16	26037.13	6.3290

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:2641110-2641881(-)

Full Sequence      

MVAFAGGSCTIKHTITNAAVNGGLFHLAARLARFTSSSFYADWAEDIWDWSAKSQLLNTD
EWWVNDAVHASRCGNVLSEAGSLYNLGQYIRGTAYMYNATNAENPQWKTRLDSLLERIFN
TFFDPWRGDGKVLVGYDDYGTNGDEYIAKGLFAADLAFVTMLAPYTAAEIIPRLQASAIA
AARQCSGGDNHKICNIHWARNRPQSAWDSAESMEEQMSARRSSLPAWLCLRTSR

Enzyme Prediction     

No EC number prediction in EAW24577.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	12	221	1.3e-43	0.5223463687150838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.92e-59	13	219	148	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13375.1|GH76	5.74e-52	11	219	175	380
BCS01664.1|GH76	5.74e-52	11	219	175	380
QKX54399.1|GH76	2.96e-49	13	218	175	377
CAK44952.1|GH76	1.95e-48	13	219	177	379
CAK43770.1|GH76	2.28e-45	13	219	172	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.03e-25	12	198	194	373	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	1.77e-34	13	219	169	371	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q9P6I4|YHG6_SCHPO	1.74e-33	21	219	180	372	Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.06c PE=3 SV=1
sp|O74556|YCZ2_SCHPO	8.05e-27	17	219	181	376	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	1.22e-26	17	219	180	380	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	8.13e-26	17	219	183	377	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999986	0.000057

TMHMM  Annotations     

There is no transmembrane helices in EAW24577.1.