CAZyme Information: EAW24240.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW24240.1
• CAZy Family: PL4
• CAZyme Description: LysM domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	DS027686|CGC5	37128.76	4.1843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:1720142-1721281(-)

Full Sequence      

MMKALRFLASALALCLVDAYLVTPPGTPAPGAASACSAWVQASYGLTCDIIHRFYGMTAA
EFEEWNPSVSQLGDGCTLISGLYYCVQVNYITQSPTWTPPTTTTRSTTSSAGNGVTTPTP
TQTGMVSSCNKFYLVVSGDSCYDIAAAQGISLDNFYAWNPAVGSSCGGLWPDYYVCVGVI
SGGTTTTTTTSTTTTPTTTTSTTTTAGNGVTTPTPIQTGMVTNCNKFYLVVSGDGCYDIA
AAAGIALNDFYTWNPAVGNTCAGLWPNYYVCVGIIGGSGTTTTKTTTTTSGNGVTTPTPI
QTGMVTNCKKFYLVISGDGCYDIAAAAGIALSDFYAWNPAVGTSCAGLWPNYYVCVGI

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
212030	LysM	1.15e-09	131	175	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	4.35e-08	226	270	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	1.60e-07	310	354	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	1.03e-06	132	177	1	44	Lysin motif.
396179	LysM	6.76e-05	133	159	1	27	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ53591.1|CBM50	2.39e-144	2	358	1	355
UKZ79391.1|CBM50	1.25e-128	2	358	1	342
QYT04780.1|CBM50	2.29e-99	16	358	15	335
CCF37665.1|CBM50	5.18e-96	22	320	24	314
CAE7022339.1|CBM50	4.46e-89	25	358	121	450

PDB Hits     

EAW24240.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALG0|LYSM1_ARTBC	3.65e-80	30	357	149	456	LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05157 PE=1 SV=1
sp|D4B5F9|PGDA_ARTBC	3.48e-19	121	179	379	437	Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03699 PE=1 SV=2
sp|D4B4P8|LYSM2_ARTBC	7.32e-15	36	182	29	184	LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03438 PE=3 SV=1
sp|D4AVW3|LYSM5_ARTBC	2.87e-12	24	179	356	536	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2
sp|D4AY86|LYSM6_ARTBC	1.60e-07	118	177	360	419	LysM domain-containing protein ARB_01155/01156 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01155/01156 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999741	CS pos: 19-20. Pr: 0.9617

TMHMM  Annotations     

There is no transmembrane helices in EAW24240.1.