CAZyme Information: EAW24040.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW24040.1
• CAZy Family: GT90
• CAZyme Description: Spherulation-specific family 4-domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A1CZ70]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	DS027686|CGC9	98274.98	3.9848

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:1060908-1064131(-)

Full Sequence      

MAPPMLLLLSLGFLFSILAHADDEYFPVGDLSQYTTDGVPTPVLTGSVIEITAVATAPAE
IDSKCYQEVLDVLEGPGWTLQSRSLNSPALEPRVLAYLGAGAIAVIGFIIAKVYQSDKVI
PVPIKIPPEQLEDSFNMETATAIVFIMDDGQPAQTITQPPEQDRATGLPATTTTFASAGN
GASAGDVGIELDSTVAAHLQALLSGSDNSNCDVGADFFPSSSLRAPSLDMASVICGAENI
LADGIGRDGYPDWLLMNQGGFPWTNVAGVKTVVQWALTQADRLNPAISASHLHGLAVGAF
ALSWLYFTNGAITTNNVIPAASLQGGPTATVCQAQTATQCGVECEVQTFAPQFACSTACL
TVTSCDAQDALTTTLTATMTAVGADPTGNSSTAPGQGQQIAVASYINPLGDPAAWNWLIA
YDVKKMPILVANVVNGPDSALDLNWQSVIQRASAAGKTVLGYVRTGYLGLYGDNIVGIIF
DEGWPECGDNNDYADLYKYIDAYTKRAHPGAFTVLNPGLPIASCFEDTMDSLLTFELNCD
SYINFYTPNGWTPNDPRKLWHIVYNVPESAVSEVANLAKERGVGFLQLTDDSLPNPYDTL
PADSYVQSMMDAISGGSPLNTDAASWTSGGAAGAVSGLFVVTSDYSSAKLSWNAASNALG
YHVYSGDSVVASVLSSMTMITIGGLASGTSYMFHADILVPYSFVRLYLWDSVGCEFDTDP
GWSVNFKVDSYVCTHYMVEGTTLYKYSGVLPEGSTAPPWSCEVVSTITLDITGYTYKWTL
PLGTSTFDTSKFVVQAQGYNPLTNAFEPDPTAYDCEGSTMCTTPDFVKWCDQAVNTLQRY
DDPFYFATSANESGNCWGDQTRSCGVFIQGDAHCSISGNDMWNDYQNIRNIGGCKRCGSF
HREDGCLITINYVYSCDNHW

Enzyme Prediction     

No EC number prediction in EAW24040.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	6.84e-37	405	613	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
406036	MU117	1.34e-24	814	916	1	104	Meiotically up-regulated gene family. This protein was identified as being up-regulated during meiosis in S.pombe. This family of proteins is found in largely in plants and fungi. Proteins in this family are typically between 128 and 920 amino acids in length.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	9.60e-167	397	918	488	1109
BCR99052.1|GH0	9.60e-167	397	918	488	1109
UNO38501.1|CE3|GH0	1.08e-83	391	813	490	990
SBO94845.1|GH0	1.02e-40	398	693	19	345
UBU17109.1|GH135	1.15e-40	398	693	34	360

PDB Hits     

EAW24040.1 has no PDB hit.

Swiss-Prot Hits     

EAW24040.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999770	CS pos: 21-22. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in EAW24040.1.