CAZyme Information: EAW23905.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW23905.1
• CAZy Family: GT20
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1487	DS027686|CGC18	166360.40	4.8525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:632734-637419(-)

Full Sequence      

MAIGLGSVTSWRLCCVVLAALTPVVRGSPSVNVALQASFDSAPYLLELLETAAEENSTSY
FPLLDRIAEGTFDDATTEKQLYDRFLQVVYDDGHLSAPELLSSFKLSLAIRSAAPRITAH
YQFYNASVQHSLMAAQDAACPVWVHSEGKQYCSSSMERAQQDVMGESDPRELPFDRVLGD
ISLPPAILYGDIASPMFRDFHHTLSTLAKEGQVSYRVRYRPPQHWISRPLFVSGYGVELA
LKRTDYIVIDDRDAGKRSQKDSGSSESASVEEESPDDLGALSSSEVARLGLNTVSYVMDS
EEPLDTLVRISQDFPKHSAKIAAYSASDALLKDIRTSRLGMLPSGVNAMWINGVQIDPRQ
VDAFTLLDHLRRERKLIDKFRGIGLSAKEAVDLLCHQTLGETLAKDSPPRYNYRDQIEGG
GVIIWMNDLEKDTKYQSWPDDLSAYLQPMYPGQLPAVRRDAHNIVAPVDLTSSDDMELVV
KTLQVFVKRKIPVRFGLVPLASSPGSVAQLKVAHYLHETFGLASLIHYLEESAAKKKIGS
PDKATFQHATKDRTSRPNKQIRSFDEILKSDELEILVSRTKQYQDRLGIKGNAPYILVNG
VFVPRDDNWPQEMSMRVGRDLQTIQQGVVDGSIEEDTWLPELFLSEAFDRRNPLIIPEDS
KDIRIVDISKLAESRGESADTLRISSETDTLDSKHLIVVGDFDSENGLKLLVEALEHRET
HGEVEMVLIHNPAPDVETESGSTLVYNSLKGTDKVDASRVLSDLKTAEITNFPETEAKKM
SQFWEAQQALARDLGFSPGTNGVIVNGRAIGPLPDGSTLSKEDLDGLLAYEQARRIGPVA
KAAKDLGLESKLSGPLALAELSSLAALSTVSDVPEGIFEQMSNIRMDLFKKWNDLRSVIT
VSTSEDPAIIIAASIDPTSETAQKWLPILKVLSKLAGVRVTLALNPRDEIQELPTKRFYR
YVLDSEPSFNDDGTLARPTATFSGVPVEALLTLGMDVPSPWLVAPKESIYDLDNIKLSSL
KPDANVDAIYALEHILIEGHSRDVTVKTAPRGVQLILGTEDNPHFADTIIMANLDYFQFK
AQPGLWKINLKPGRSQRIFNLDSVGGQGYSPHPGDENSEVALLSFQGKTLFPRLSRKKGQ
EMEDVLDTDVKSGSAMDYVSKGFNFAQGVLSSVGVGSKDGLAEKQADINIFSVASGHLYE
RMLNIMMVSVMRNTKHTVKFWFIEQFLSPSFKSFLPDLAKEYGFSYEMVTYKWPHWLRAQ
REKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYDLVSLDLEGAPYGFTPMCDS
REEMEGFRFWKQGYWKNFLRGLPYHISALYVVDLNRFRALAAGDRLRGQYQMLSADPNSL
SNLDQDLPNHMQHHIPIKSLPQEWLWCETWCSDESLSTARTIDLCNNPQTKEPKLDRARR
QVPEWTKYDDEIAALAERVALEQQRQQLEEMESADQDEESGWEKDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1188	1435	1.9e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1188	1435	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1188	1455	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	8.53e-100	411	655	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	1.26e-64	41	228	1	185	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	3.91e-62	667	866	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE65008.1|GT24|2.4.1.-	0.0	1	1487	1	1487
UDD64319.1|GT24	0.0	5	1487	5	1487
QRD91624.1|GT24	0.0	1	1487	1	1487
QMW47293.1|GT24	0.0	1	1487	1	1487
QMW35231.1|GT24	0.0	1	1487	1	1487

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5Y7O_A	0.0	30	1153	5	1130	Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii],5Y7O_B Crystal structure of folding sensor region of UGGT from Thermomyces dupontii [Thermomyces dupontii]
6TRT_A	0.0	22	1462	2	1454	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	22	1462	2	1220	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.18e-286	18	1455	9	1424	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.33e-242	28	1455	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	7.66e-241	28	1455	44	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	4.87e-239	17	1464	33	1532	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q09332|UGGG_DROME	1.68e-231	16	1459	11	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000222	0.999744	CS pos: 27-28. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in EAW23905.1.