CAZyme Information: EAW23729.1

Basic Information

• Species: Aspergillus fischeri
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus fischeri
• CAZyme ID: EAW23729.1
• CAZy Family: GT2
• CAZyme Description: glycosyl hydrolase, putative

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	DS027686|CGC26	40791.04	4.2730

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AfischeriNRRL181	10668	331117	278	10390

• Gene Location: location=DS027686:174425-175640(-)

Full Sequence      

MLPELVFLVLAPSAAAATPTTRAETALAALQTWYNTTSGIWNTCGWWNGANCMTVIADLA
DVDDSVREVAVGVFDNTFSVAPRSNPAPGRGNDTYNGAIKHHRPQPVSRRRAGVDVSQWL
DGAYDDDAWWALAWIAAFDVTGRQEYLDLAEGVFEELSKVWPSRCGGGIYWDYTHTYVNA
IANELFLSLAAHLANRASNKEYYVDWAQREWDWFQGSGMINANHTINDGLTESCENNGQT
TWTYNQGVILGGLAELYRASPNETFLESAGEIARAAIAALSDSNGVLHEPCEPSSCTGDS
TQFKGIFIRNLRLLHSVAPDEEYSRVITASADSIWANDRDANNQMGVNWAGPIEQVDASS
HSSAMDALVAAIGL

Enzyme Prediction     

No EC number prediction in EAW23729.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	21	364	1e-97	0.9106145251396648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	1.09e-42	139	350	106	331	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	8.14e-13	81	371	58	349	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
271198	LanC_like	8.90e-04	139	330	16	246	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31905.1|GH76	4.52e-172	22	374	27	374
QRD90972.1|GH76	4.52e-172	22	374	27	374
QMW43938.1|GH76	4.52e-172	22	374	27	374
BAE61149.1|GH76	4.52e-172	22	374	27	374
UDD60869.1|GH76	4.52e-172	22	374	27	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	4.67e-19	124	349	91	314	Chain A, Lin0763 protein [Listeria innocua]
4BOK_A	6.42e-16	92	364	69	332	Chain A, Alpha-1,6-mannanase [Niallia circulans]
4BOJ_A	6.59e-16	92	364	72	335	Chain A, Alpha-1,6-mannanase [Niallia circulans],4BOJ_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4BOJ_C Chain C, Alpha-1,6-mannanase [Niallia circulans]
4D4A_A	2.51e-15	92	364	90	353	Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4A_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4B_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4B_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4C_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4C_B Chain B, Alpha-1,6-mannanase [Niallia circulans],4D4D_A Chain A, Alpha-1,6-mannanase [Niallia circulans],4D4D_B Chain B, Alpha-1,6-mannanase [Niallia circulans],5N0F_A Chain A, Alpha-1,6-mannanase [Niallia circulans],5N0F_B Chain B, Alpha-1,6-mannanase [Niallia circulans],6ZBX_A Chain A, Alpha-1,6-mannanase [Niallia circulans],6ZBX_B Chain B, Alpha-1,6-mannanase [Niallia circulans],7NL5_A Chain A, Alpha-1,6-mannanase [Niallia circulans]
5M77_A	5.06e-15	92	364	103	366	Chain A, Alpha-1,6-mannanase [Niallia circulans],5M77_B Chain B, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P6I3|YHG7_SCHPO	9.50e-26	117	319	100	318	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q5ACZ2|DFG5_CANAL	2.75e-23	114	372	108	389	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DFG5 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	2.77e-23	114	322	103	330	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	4.74e-23	91	319	81	323	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.33e-22	92	320	84	327	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000479	0.999494	CS pos: 17-18. Pr: 0.7601

TMHMM  Annotations     

There is no transmembrane helices in EAW23729.1.